Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23391_WB10.jpg WB (Western Blot) (WB Suggested Anti-NR5A1 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit NR5A1 Polyclonal Antibody | anti-NR5A1 antibody

NR5A1 antibody - middle region

Gene Names
NR5A1; ELP; SF1; FTZ1; POF7; SF-1; AD4BP; FTZF1; SPGF8; SRXX4; SRXY3; hSF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR5A1, Antibody; NR5A1 antibody - middle region; anti-NR5A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP
Sequence Length
461
Applicable Applications for anti-NR5A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 79%; Rabbit: 85%; Rat: 92%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NR5A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NR5A1 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23391_WB10.jpg WB (Western Blot) (WB Suggested Anti-NR5A1 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-NR5A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateNR5A1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23391_WB9.jpg WB (Western Blot) (WB Suggested Anti-NR5A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateNR5A1 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NR5A1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23391_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: NR5A1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Human Liver)

product-image-AAA23391_IHC2.jpg IHC (Immunohistochemistry) (Human Liver)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA23391_IHC.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-NR5A1 antibody
This is a rabbit polyclonal antibody against NR5A1. It was validated on Western Blot and immunohistochemistry

Target Description: NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
steroidogenic factor 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 5 group A member 1
NCBI Official Symbol
NR5A1
NCBI Official Synonym Symbols
ELP; SF1; FTZ1; POF7; SF-1; AD4BP; FTZF1; SPGF8; SRXX4; SRXY3; hSF-1
NCBI Protein Information
steroidogenic factor 1
UniProt Protein Name
Steroidogenic factor 1
UniProt Gene Name
NR5A1
UniProt Synonym Gene Names
AD4BP; FTZF1; SF1; SF-1; STF-1
UniProt Entry Name
STF1_HUMAN

Similar Products

Product Notes

The NR5A1 nr5a1 (Catalog #AAA23391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR5A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's NR5A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NR5A1 nr5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVPGAHGPLA GYLYPAFPGR AIKSEYPEPY ASPPQPGLPY GYPEPFSGGP. It is sometimes possible for the material contained within the vial of "NR5A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.