Rabbit NTRK2 Polyclonal Antibody | anti-NTRK2 antibody
NTRK2 antibody - C-terminal region
Gene Names
NTRK2; OBHD; TRKB; trk-B; EIEE58; GP145-TrkB
Reactivity
Tested Species Reactivity: Human, MousePredicted Species Reactivity: Cow, Horse, Human, Rabbit, Rat
Applications
Western Blot, Immunofluorescence, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NTRK2, Antibody; NTRK2 antibody - C-terminal region; anti-NTRK2 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Cow, Horse, Human, Rabbit, Rat
Predicted Species Reactivity: Cow, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: DFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPD
Sequence Length
553
Applicable Applications for anti-NTRK2 antibody
WB (Western Blot), IF (Immunofluorescence), IHC (Immunohistochemistry)
Homology
Cow: 88%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK2
Protein Size (#AA)
553 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-NTRK2 antibody
This is a rabbit polyclonal antibody against NTRK2. It was validated on Western Blot
Target Description: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders.
Target Description: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders.
Product Categories/Family for anti-NTRK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57kDa
NCBI Official Full Name
BDNF/NT-3 growth factors receptor isoform d
NCBI Official Synonym Full Names
neurotrophic receptor tyrosine kinase 2
NCBI Official Symbol
NTRK2
NCBI Official Synonym Symbols
OBHD; TRKB; trk-B; EIEE58; GP145-TrkB
NCBI Protein Information
BDNF/NT-3 growth factors receptor
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The NTRK2 (Catalog #AAA200149) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NTRK2 antibody - C-terminal region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Cow, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NTRK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NTRK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFSWFGFGKV KSRQGVGPAS VISNDDDSAS PLHHISNGSN TPSSSEGGPD. It is sometimes possible for the material contained within the vial of "NTRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
