Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281015_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of 293T cells using 1ug NUDT1 antibody. Western blot was performed from the immunoprecipitate using NUDT1 antibody at a dilition of 1:1000.)

Rabbit anti-Human NUDT1 Polyclonal Antibody | anti-NUDT1 antibody

NUDT1 Polyclonal Antibody

Gene Names
NUDT1; MTH1
Reactivity
Human
Applications
Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
NUDT1, Antibody; NUDT1 Polyclonal Antibody; MTH1; anti-NUDT1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Sequence Length
156
Applicable Applications for anti-NUDT1 antibody
IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human NUDT1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Mitochondrion matrix, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of 293T cells using 1ug NUDT1 antibody. Western blot was performed from the immunoprecipitate using NUDT1 antibody at a dilition of 1:1000.)

product-image-AAA281015_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of 293T cells using 1ug NUDT1 antibody. Western blot was performed from the immunoprecipitate using NUDT1 antibody at a dilition of 1:1000.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human gastric cancer using NUDT1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281015_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human gastric cancer using NUDT1 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NUDT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA281015_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NUDT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-NUDT1 antibody
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Product Categories/Family for anti-NUDT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 17kDa; 19kDa; 20kDa; 22kDa
Observed: 18kDa
NCBI Official Full Name
7,8-dihydro-8-oxoguanine triphosphatase isoform p18
NCBI Official Synonym Full Names
nudix hydrolase 1
NCBI Official Symbol
NUDT1
NCBI Official Synonym Symbols
MTH1
NCBI Protein Information
7,8-dihydro-8-oxoguanine triphosphatase
UniProt Protein Name
7,8-dihydro-8-oxoguanine triphosphatase
UniProt Gene Name
NUDT1
UniProt Synonym Gene Names
MTH1; Nudix motif 1

Similar Products

Product Notes

The NUDT1 nudt1 (Catalog #AAA281015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NUDT1 nudt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGISPQQMG EPEGSWSGKN PGTMGASRLY TLVLVLQPQR VLLGMKKRGF GAGRWNGFGG KVQEGETIED GARRELQEES GLTVDALHKV GQIVFEFVGE PELMDVHVFC TDSIQGTPVE SDEMRPCWFQ LDQIPFKDMW PDDSYWFPLL LQKKKFHGYF KFQGQDTILD YTLREVDTV. It is sometimes possible for the material contained within the vial of "NUDT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.