Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282345_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse heart using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit OBSCN Polyclonal Antibody | anti-OBSCN antibody

OBSCN Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
OBSCN, Antibody; OBSCN Rabbit pAb; ARHGEF30; UNC89; OBSCN; anti-OBSCN antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
PYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPT
Applicable Applications for anti-OBSCN antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1621-1710 of human OBSCN (NP_443075.3).
Cellular Location
cytosol, M band, myofibril, nuclear body, plasma membrane, sarcolemma, Z disc
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse heart using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282345_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse heart using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat heart using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282345_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat heart using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282345_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using OBSCN antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-OBSCN antibody
The obscurin gene spans more than 150 kb, contains over 80 exons and encodes a protein of approximately 720 kDa. The encoded protein contains 68 Ig domains, 2 fibronectin domains, 1 calcium/calmodulin-binding domain, 1 RhoGEF domain with an associated PH domain, and 2 serine-threonine kinase domains. This protein belongs to the family of giant sacromeric signaling proteins that includes titin and nebulin, and may have a role in the organization of myofibrils during assembly and may mediate interactions between the sarcoplasmic reticulum and myofibrils. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
947
UniProt Accession #
Molecular Weight
40,716 Da
NCBI Official Full Name
CD34
NCBI Official Synonym Full Names
CD34 molecule
NCBI Official Symbol
CD34
NCBI Protein Information
hematopoietic progenitor cell antigen CD34; CD34 antigen
UniProt Protein Name
Hematopoietic progenitor cell antigen CD34
UniProt Gene Name
CD34
UniProt Entry Name
CD34_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OBSCN cd34 (Catalog #AAA282345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OBSCN Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OBSCN can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the OBSCN cd34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PYTSSSPILS DIKAEIKCSG IREVKLTQGI CLEQNKTSSC AEFKKDRGEG LARVLCGEEQ ADADAGAQVC SLLLAQSEVR PQCLLLVLAN RTEISSKLQL MKKHQSDLKK LGILDFTEQD VASHQSYSQK TLIALVTSGA LLAVLGITGY FLMNRRSWSP T. It is sometimes possible for the material contained within the vial of "OBSCN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.