Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46481_IHC11.jpg IHC (Immunohistochemisry) (Anti- OGT Picoband antibody, AAA46481,IHC(P)IHC(P): Rat Intestine Tissue)

OGT Polyclonal Antibody | anti-OGT antibody

Anti-OGT Antibody

Average rating 0.0
No ratings yet
Gene Names
OGT; HRNT1; HINCUT-1; O-GLCNAC
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
OGT, Antibody; Anti-OGT Antibody; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; FLJ23071; GlcNAc transferase; HRNT1; MGC22921; O GlcNAc; O GlcNAc transferase p110 subunit; O GlcNAc transferase subunit p110; O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine: polypeptide N acetylglucosaminyl transferase); O linked N acetylglucosamine (GlcNAc) transferase; O linked N acetylglucosamine transferase 110 kDa subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine transferase 110 kDa subunit; ogt; OGT1_HUMAN; UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit; UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase; O-linked N-acetylglucosamine (GlcNAc) transferase; anti-OGT antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1046
Applicable Applications for anti-OGT antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- OGT Picoband antibody, AAA46481,IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46481_IHC11.jpg IHC (Immunohistochemisry) (Anti- OGT Picoband antibody, AAA46481,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- OGT Picoband antibody, AAA46481,IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46481_IHC13.jpg IHC (Immunohiostchemistry) (Anti- OGT Picoband antibody, AAA46481,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- OGT Picoband antibody, AAA46481, Western blottingAll lanes: Anti OGT (AAA46481) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 4: A549 Whole Cell Lysate at 40ugPredicted bind size: 117KDObserved bind size: 117KD)

product-image-AAA46481_WB15.jpg WB (Western Blot) (Anti- OGT Picoband antibody, AAA46481, Western blottingAll lanes: Anti OGT (AAA46481) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 4: A549 Whole Cell Lysate at 40ugPredicted bind size: 117KDObserved bind size: 117KD)
Related Product Information for anti-OGT antibody
Description: Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
References
1. "Entrez Gene: OGT O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine: polypeptide-N -acetylglucosaminyl transferase)". 2. Lubas WA, Frank DW, Krause M, Hanover JA (Apr 1997). "O-Linked GlcNAc transferase is a conserved nucleocytoplasmic protein containing tetratricopeptide repeats". The Journal of Biological Chemistry 272(14): 9316-24. 3. Yang X, Ongusaha PP, Miles PD, Havstad JC, Zhang F, So WV, Kudlow JE, Michell RH, Olefsky JM, Field SJ, Evans RM (Feb 2008). "Phosphoinositide signalling links O-GlcNAc transferase to insulin resistance". Nature 451 (7181): 964-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,536 Da
NCBI Official Full Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform 1
NCBI Official Synonym Full Names
O-linked N-acetylglucosamine (GlcNAc) transferase
NCBI Official Symbol
OGT
NCBI Official Synonym Symbols
HRNT1; HINCUT-1; O-GLCNAC
NCBI Protein Information
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
UniProt Protein Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
UniProt Gene Name
OGT
UniProt Synonym Gene Names
OGT
UniProt Entry Name
OGT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OGT ogt (Catalog #AAA46481) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-OGT Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OGT can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the OGT ogt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OGT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.