Rabbit OLAH Polyclonal Antibody | anti-OLAH antibody
OLAH antibody - N-terminal region
Gene Names
OLAH; TE2; SAST; AURA1; THEDC1
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OLAH, Antibody; OLAH antibody - N-terminal region; anti-OLAH antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Horse, Pig, Rabbit
Predicted Species Reactivity: Human, Mouse, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
Sequence Length
265
Applicable Applications for anti-OLAH antibody
WB (Western Blot)
Homology
Horse: 83%; Human: 100%; Mouse: 77%; Pig: 79%; Rabbit: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH
Blocking Peptide
For anti-OLAH (MBS3212666) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-OLAH antibody
This is a rabbit polyclonal antibody against OLAH. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
Target Description: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
Product Categories/Family for anti-OLAH antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
S-acyl fatty acid synthase thioesterase, medium chain isoform 2
NCBI Official Synonym Full Names
oleoyl-ACP hydrolase
NCBI Official Symbol
OLAH
NCBI Official Synonym Symbols
TE2; SAST; AURA1; THEDC1
NCBI Protein Information
S-acyl fatty acid synthase thioesterase, medium chain
UniProt Protein Name
S-acyl fatty acid synthase thioesterase, medium chain
UniProt Gene Name
OLAH
UniProt Synonym Gene Names
THEDC1; AURA1
UniProt Entry Name
SAST_HUMAN
Similar Products
Product Notes
The OLAH olah (Catalog #AAA200564) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OLAH antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's OLAH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the OLAH olah for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGGGSTHFAK WGQDTHDLLE VHSLRLPGRE SRVEEPLEND ISQLVDEVVC. It is sometimes possible for the material contained within the vial of "OLAH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
