Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23547_WB8.jpg WB (Western Blot)

Rabbit OMA1 Polyclonal Antibody | anti-OMA1 antibody

OMA1 antibody - middle region

Gene Names
OMA1; DAB1; MPRP1; MPRP-1; YKR087C; ZMPOMA1; peptidase; 2010001O09Rik
Reactivity
Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OMA1, Antibody; OMA1 antibody - middle region; Metalloendopeptidase OMA1, mitochondrial; anti-OMA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Sequence Length
524
Applicable Applications for anti-OMA1 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%; Yeast: 83%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OMA1
Protein Size
524 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

product-image-AAA23547_WB8.jpg WB (Western Blot)

WB (Western Blot)

(Host: RabbitTarget name: OMA1Positive control: ~25ug Human Lung Tumor (T-LU)Negative control: ~25ug 293T Cell Lysate (2T)Antibody concentration: 5ug/ml)

product-image-AAA23547_WB7.jpg WB (Western Blot) (Host: RabbitTarget name: OMA1Positive control: ~25ug Human Lung Tumor (T-LU)Negative control: ~25ug 293T Cell Lysate (2T)Antibody concentration: 5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: OMA1Sample Type: HT1080 Cell LysateAntibody Dilution: 1.0ug/ml)

product-image-AAA23547_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: OMA1Sample Type: HT1080 Cell LysateAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

product-image-AAA23547_WB5.jpg WB (Western Blot) (WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

WB (Western Blot)

(Researcher: Oleh Khalimonchuk, University of Nebraska-LincolnApplication: Western blotSpecies + Tissue/Cell type: Lane1: 10ug human fibroblast mitochondria, Lane2: 15ug fish embryo lysate; 6h post fertilization, Lane3: 30ug fish embryo lysate, 6 daysPrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)

product-image-AAA23547_WB4.jpg WB (Western Blot) (Researcher: Oleh Khalimonchuk, University of Nebraska-LincolnApplication: Western blotSpecies + Tissue/Cell type: Lane1: 10ug human fibroblast mitochondria, Lane2: 15ug fish embryo lysate; 6h post fertilization, Lane3: 30ug fish embryo lysate, 6 daysPrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)

WB (Western Blot)

(Lanes:Lane1: 10ug human fibroblast mitochondriaLane2: 15ug fish embryo lysate; 6h post fertilizationLane3: 30ug fish embryo lysate, 6 daysPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:OMA1Submitted by:Oleh Khalimonchuk, University of Nebraska-Lincoln)

product-image-AAA23547_WB3.jpg WB (Western Blot) (Lanes:Lane1: 10ug human fibroblast mitochondriaLane2: 15ug fish embryo lysate; 6h post fertilizationLane3: 30ug fish embryo lysate, 6 daysPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-Rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:OMA1Submitted by:Oleh Khalimonchuk, University of Nebraska-Lincoln)

WB (Western Blot)

(Host: RabbitTarget Name: OMA1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA23547_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: OMA1Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: NuclearSample Type: HepG2 cellsPrimary Dilution: 1:1000Secondary Antibody: anti-Rabbit TBST with 5% BSASecondary Dilution: 1:5000Image Submitted by: Hana SabicUniversity of Utah)

product-image-AAA23547_WB.jpg WB (Western Blot) (Sample Type: NuclearSample Type: HepG2 cellsPrimary Dilution: 1:1000Secondary Antibody: anti-Rabbit TBST with 5% BSASecondary Dilution: 1:5000Image Submitted by: Hana SabicUniversity of Utah)
Related Product Information for anti-OMA1 antibody
This is a rabbit polyclonal antibody against OMA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OMA1 is a mitochondrial protease.
Product Categories/Family for anti-OMA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60
NCBI Official Full Name
metalloendopeptidase OMA1, mitochondrial
NCBI Official Synonym Full Names
OMA1 zinc metallopeptidase
NCBI Official Symbol
OMA1
NCBI Official Synonym Symbols
DAB1; MPRP1; MPRP-1; YKR087C; ZMPOMA1; peptidase; 2010001O09Rik
NCBI Protein Information
metalloendopeptidase OMA1, mitochondrial
UniProt Protein Name
Metalloendopeptidase OMA1, mitochondrial
UniProt Gene Name
OMA1
UniProt Synonym Gene Names
MPRP1; MPRP-1
UniProt Entry Name
OMA1_HUMAN

Similar Products

Product Notes

The OMA1 oma1 (Catalog #AAA23547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OMA1 antibody - middle region reacts with Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OMA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OMA1 oma1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WAICPRDSLA LLCQWIQSKL QEYMFNRPYS RKLEAEADKI GLLLAAKACA. It is sometimes possible for the material contained within the vial of "OMA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.