Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23571_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: OMPSample Tissue: Human U937 Whole CellAntibody Dilution: 5ug/ml)

Rabbit OMP Polyclonal Antibody | anti-OMP antibody

OMP antibody - middle region

Reactivity
Tested Reactivity: Human, Rat
Predicted Species Reactivity: Goat, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OMP, Antibody; OMP antibody - middle region; anti-OMP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human, Rat
Predicted Species Reactivity: Goat, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA
Sequence Length
163
Applicable Applications for anti-OMP antibody
Western Blot (WB)
Predicted Homology Based on Immunogen Sequence
Goat: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human OMP
Protein Size (#AA)
163 amino acids
Protein Interactions
BEX2; BEX1;
Blocking Peptide
For anti-OMP (AAA23571) antibody is Catalog #
Sample Type Confirmation
OMP is supported by BioGPS gene expression data to be expressed in 721_B
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: OMPSample Tissue: Human U937 Whole CellAntibody Dilution: 5ug/ml)

product-image-AAA23571_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: OMPSample Tissue: Human U937 Whole CellAntibody Dilution: 5ug/ml)

WB (Western Blot)

(WB Suggested Anti-OMP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA23571_WB3.jpg WB (Western Blot) (WB Suggested Anti-OMP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RatTarget Name: OMPSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

product-image-AAA23571_WB2.jpg WB (Western Blot) (Host: RatTarget Name: OMPSample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: OMPSample Type: 721_BAntibody Dilution: 1.0ug/mlOMP is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23571_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: OMPSample Type: 721_BAntibody Dilution: 1.0ug/mlOMP is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-OMP antibody
Target Description: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.
Product Categories/Family for anti-OMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
olfactory marker protein
NCBI Official Synonym Full Names
olfactory marker protein
NCBI Official Symbol
OMP
NCBI Protein Information
olfactory marker protein
UniProt Protein Name
Olfactory marker protein
UniProt Gene Name
OMP
UniProt Entry Name
OMP_HUMAN

Similar Products

Product Notes

The OMP omp (Catalog #AAA23571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OMP antibody - middle region reacts with Tested Reactivity: Human, Rat Predicted Species Reactivity: Goat, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OMP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OMP omp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WRKEDSDAID WNEADALEFG ERLSDLAKIR KVMYFLVTFG EGVEPANLKA. It is sometimes possible for the material contained within the vial of "OMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.