Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46282_IHC10.jpg IHC (Immunohistochemistry) (Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Human Glioma Tissue)

Rabbit Otoferlin Polyclonal Antibody | anti-OTOF antibody

Anti-Otoferlin Antibody

Average rating 0.0
No ratings yet
Gene Names
OTOF; AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Otoferlin, Antibody; Anti-Otoferlin Antibody; Otoferlin; AUNB1; Deafness, autosomal recessive 9; DFNB6; DFNB9; Fer 1 like protein 2; Fer-1-like protein 2; FER1L2; NSRD9; Otof; OTOF_HUMAN; otoferlin; anti-OTOF antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1997
Applicable Applications for anti-OTOF antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
The labs provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit in Western Blot (WB), supported by
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Human Glioma Tissue)

product-image-AAA46282_IHC10.jpg IHC (Immunohistochemistry) (Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Human Glioma Tissue)

IHC (Immunohistochemisry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46282_IHC11.jpg IHC (Immunohistochemisry) (Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46282_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- Otoferlin Picoband antibody, AAA46282, Western blottingAll lanes: Anti Otoferlin (AAA46282) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD)

product-image-AAA46282_WB15.jpg WB (Western Blot) (Anti- Otoferlin Picoband antibody, AAA46282, Western blottingAll lanes: Anti Otoferlin (AAA46282) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD)
Related Product Information for anti-OTOF antibody
Description: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.
References
1. "Entrez Gene: OTOF otoferlin". 2. Rodriguez-Ballesteros M, Reynoso R, Olarte M, Villamar M, Morera C, Santarelli R, Arslan E, Meda C, Curet C, Volter C, Sainz-Quevedo M, Castorina P, Ambrosetti U, Berrettini S, Frei K, Tedin S, Smith J, Cruz Tapia M, Cavalle L, Gelvez N, Primignani P, Gomez-Rosas E, Martin M, Moreno-Pelayo MA, Tamayo M, Moreno-Barral J, Moreno F, del Castillo I (May 2008). "A multicenter study on the prevalence and spectrum of mutations in the otoferlin gene (OTOF) in subjects with nonsyndromic hearing impairment and auditory neuropathy". Hum Mutat 29(6): 823-31. 3. Yasunaga S, Grati M, Cohen-Salmon M, El-Amraoui A, Mustapha M, Salem N, El-Zir E, Loiselet J, Petit C (Apr 1999). "A mutation in OTOF, encoding otoferlin, a FER-1-like protein, causes DFNB9, a nonsyndromic form of deafness". Nat Genet 21 (4): 363-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
otoferlin isoform e
NCBI Official Synonym Full Names
otoferlin
NCBI Official Symbol
OTOF
NCBI Official Synonym Symbols
AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
NCBI Protein Information
otoferlin
UniProt Protein Name
Otoferlin
UniProt Gene Name
OTOF
UniProt Synonym Gene Names
FER1L2
UniProt Entry Name
OTOF_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The OTOF otof (Catalog #AAA46282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Otoferlin Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Otoferlin can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the OTOF otof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Otoferlin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.