Rabbit Otoferlin Polyclonal Antibody | anti-OTOF antibody

Anti-Otoferlin Antibody

Cat. Num. AAA46282

• Gene Names: OTOF; AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: Otoferlin, Antibody; Anti-Otoferlin Antibody; Otoferlin; AUNB1; Deafness, autosomal recessive 9; DFNB6; DFNB9; Fer 1 like protein 2; Fer-1-like protein 2; FER1L2; NSRD9; Otof; OTOF_HUMAN; otoferlin; anti-OTOF antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1997

• Applicable Applications for anti-OTOF antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Relevant Detection Systems: The labs provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit in Western Blot (WB), supported by
• Preparation and Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Human Glioma Tissue)

IHC (Immunohistochemisry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Otoferlin Picoband antibody, AAA46282,IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- Otoferlin Picoband antibody, AAA46282, Western blottingAll lanes: Anti Otoferlin (AAA46282) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: 293T Whole Cell Lysate at 40ugPredicted bind size: 227KDObserved bind size: 227KD)

Related Product Information for anti-OTOF antibody

Description: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

References

1. "Entrez Gene: OTOF otoferlin". 2. Rodriguez-Ballesteros M, Reynoso R, Olarte M, Villamar M, Morera C, Santarelli R, Arslan E, Meda C, Curet C, Volter C, Sainz-Quevedo M, Castorina P, Ambrosetti U, Berrettini S, Frei K, Tedin S, Smith J, Cruz Tapia M, Cavalle L, Gelvez N, Primignani P, Gomez-Rosas E, Martin M, Moreno-Pelayo MA, Tamayo M, Moreno-Barral J, Moreno F, del Castillo I (May 2008). "A multicenter study on the prevalence and spectrum of mutations in the otoferlin gene (OTOF) in subjects with nonsyndromic hearing impairment and auditory neuropathy". Hum Mutat 29(6): 823-31. 3. Yasunaga S, Grati M, Cohen-Salmon M, El-Amraoui A, Mustapha M, Salem N, El-Zir E, Loiselet J, Petit C (Apr 1999). "A mutation in OTOF, encoding otoferlin, a FER-1-like protein, causes DFNB9, a nonsyndromic form of deafness". Nat Genet 21 (4): 363-9.

NCBI and Uniprot Product Information

• NCBI GI #: 566559996
• NCBI GeneID: 9381
• NCBI Accession #: NP_001274418.1
• NCBI GenBank Nucleotide #: NM_001287489.1
• UniProt Accession #: Q9HC10; Q53R90; Q9HC08; Q9HC09; Q9Y650; B4DJX0; B5MCC1; B9A0H6
• NCBI Official Full Name: otoferlin isoform e
• NCBI Official Synonym Full Names: otoferlin
• NCBI Official Symbol: OTOF
• NCBI Official Synonym Symbols: AUNB1; DFNB6; DFNB9; NSRD9; FER1L2
• NCBI Protein Information: otoferlin
• UniProt Protein Name: Otoferlin
• UniProt Gene Name: OTOF
• UniProt Synonym Gene Names: FER1L2
• UniProt Entry Name: OTOF_HUMAN