anti-Human, Rat PACE4 Polyclonal Antibody | anti-PACE4 antibody
Anti-PACE4 Antibody
Gene Names
PCSK6; SPC4; PACE4
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PACE4, Antibody; Anti-PACE4 Antibody; Proprotein convertase subtilisin/kexin type 6; Paired basic amino acid cleaving enzyme 4; Paired basic amino acid cleaving system 4; PCSK6; PCSK6_HUMAN; SPC4; Subtilisin like protease; Subtilisin-like proprotein convertase 4; subtilisin/kexin like protease PACE4; Subtilisin/kexin-like protease PACE4; proprotein convertase subtilisin/kexin type 6; anti-PACE4 antibody
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
No cross reactivity with other proteins
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
895
Applicable Applications for anti-PACE4 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
The lab provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit ( ) in Western Blot (WB).
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-PACE4 antibody
Background: Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene. This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired. The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, including neuroendocrine, liver, gut, and brain. This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression and left-right patterning. Alternatively spliced transcript variants encoding different isoforms have been identified.
References
1. "Entrez Gene: PCSK6 proprotein convertase subtilisin/kexin type 6". 2. Constam DB, Robertson EJ (May 1, 2000). "SPC4/PACE4 regulates a TGFbeta signaling network during axis formation.". Genes & Development 14 (9): 1146-55. 3. Scerri TS, Brandler WM, Paracchini S, Morris AP, Ring SM, Richardson AJ, Talcott JB, Stein J, Monaco AP (Feb 1, 2011). "PCSK6 is associated with handedness in individuals with dyslexia.". Human Molecular Genetics 20 (3): 608-14.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
proprotein convertase subtilisin/kexin type 6 isoform i preproprotein
NCBI Official Synonym Full Names
proprotein convertase subtilisin/kexin type 6
NCBI Official Symbol
PCSK6
NCBI Official Synonym Symbols
SPC4; PACE4
NCBI Protein Information
proprotein convertase subtilisin/kexin type 6
UniProt Protein Name
Proprotein convertase subtilisin/kexin type 6
UniProt Gene Name
PCSK6
UniProt Synonym Gene Names
PACE4; SPC4
UniProt Entry Name
PCSK6_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PACE4 pcsk6 (Catalog #AAA46513) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PACE4 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PACE4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PACE4 pcsk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PACE4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
