Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46454_IHC13.jpg IHC (Immunohiostchemistry) (Anti- PAK5 Picoband antibody, AAA46454, IHC(P)IHC(P): Human Glioma Tissue)

PAK5 Polyclonal Antibody | anti-PAK5 antibody

Anti-PAK5 Antibody

Gene Names
PAK7; PAK5
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PAK5, Antibody; Anti-PAK5 Antibody; Serine/threonine-protein kinase PAK 7; EC 2.7.11.1; KIAA1264; MGC26232; p21 activated kinase 7; p21 protein (Cdc42/Rac)-activated kinase 7; p21(CDKN1A) activated kinase 7; p21-activated kinase 5; p21-activated kinase 7; PAK 5; PAK 7; PAK-5; PAK-7; PAK5; PAK7; PAK7_HUMAN; Protein kinase PAK5; Serine/threonine protein kinase PAK 7; anti-PAK5 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
719
Applicable Applications for anti-PAK5 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PAK5 (26-55aa DPQEQKFTGLPQQWHSLLADTANRPKPMVD), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- PAK5 Picoband antibody, AAA46454, IHC(P)IHC(P): Human Glioma Tissue)

product-image-AAA46454_IHC13.jpg IHC (Immunohiostchemistry) (Anti- PAK5 Picoband antibody, AAA46454, IHC(P)IHC(P): Human Glioma Tissue)

WB (Western Blot)

(Anti- PAK5 Picoband antibody, AAA46454, Western blottingAll lanes: Anti PAK5 (AAA46454) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD)

product-image-AAA46454_WB15.jpg WB (Western Blot) (Anti- PAK5 Picoband antibody, AAA46454, Western blottingAll lanes: Anti PAK5 (AAA46454) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugPredicted bind size: 81KDObserved bind size: 81KD)
Related Product Information for anti-PAK5 antibody
Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase PAK 7(PAK7) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Serine/threonine-protein kinase PAK 7, also known as PAK5, is an enzyme that in humans is encoded by the PAK7 gene. The protein encoded by this gene is a member of the PAK family of Ser/Thr protein kinases. PAK family members are known to be effectors of Rac/Cdc42 GTPases, which have been implicated in the regulation of cytoskeletal dynamics, proliferation, and cell survival signaling. This kinase contains a CDC42/Rac1 interactive binding (CRIB) motif, and has been shown to bind CDC42 in the presence of GTP. And this kinase is predominantly expressed in brain. It is capable of promoting neurite outgrowth, and thus may play a role in neurite development. In addition, this kinase is associated with microtubule networks and induces microtubule stabilization. The subcellular localization of this kinase is tightly regulated during cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.
References
1. "Entrez Gene: PAK7 p21(CDKN1A)-activated kinase 7". 2. Dan C, Nath N, Liberto M, Minden A (Dec 2001). "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells". Mol Cell Biol 22 (2): 567-77. 3. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O (Jan 2000). "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro". DNA Res 6 (5): 337-45.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,745 Da
NCBI Official Full Name
serine/threonine-protein kinase PAK 7
NCBI Official Synonym Full Names
p21 (RAC1) activated kinase 7
NCBI Official Symbol
PAK7
NCBI Official Synonym Symbols
PAK5
NCBI Protein Information
serine/threonine-protein kinase PAK 7
UniProt Protein Name
Serine/threonine-protein kinase PAK 7
UniProt Gene Name
PAK7
UniProt Synonym Gene Names
KIAA1264; PAK5; PAK-5; PAK-7
UniProt Entry Name
PAK7_HUMAN

Similar Products

Product Notes

The PAK5 pak7 (Catalog #AAA46454) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PAK5 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAK5 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PAK5 pak7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.