Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201319_WB11.jpg WB (Western Blot) (WB Suggested Anti-PAM16 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellPAM16 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit PAM16 Polyclonal Antibody | anti-PAM16 antibody

PAM16 antibody - C-terminal region

Gene Names
PAM16; TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136
Reactivity
Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PAM16, Antibody; PAM16 antibody - C-terminal region; anti-PAM16 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Sequence Length
125
Applicable Applications for anti-PAM16 antibody
WB (Western Blot)
Homology
Dog: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PAM16 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellPAM16 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA201319_WB11.jpg WB (Western Blot) (WB Suggested Anti-PAM16 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellPAM16 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: PAM16Sample Type: JurkatAntibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA201319_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PAM16Sample Type: JurkatAntibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: PAM16Sample Type: HelaAntibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201319_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PAM16Sample Type: HelaAntibody Dilution: 1.0ug/mlPAM16 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-PAM16 antibody
This is a rabbit polyclonal antibody against PAM16. It was validated on Western Blot

Target Description: PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.
Product Categories/Family for anti-PAM16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
mitochondrial import inner membrane translocase subunit TIM16
NCBI Official Synonym Full Names
presequence translocase associated motor 16
NCBI Official Symbol
PAM16
NCBI Official Synonym Symbols
TIM16; MAGMAS; SMDMDM; TIMM16; CGI-136
NCBI Protein Information
mitochondrial import inner membrane translocase subunit TIM16
UniProt Protein Name
Mitochondrial import inner membrane translocase subunit TIM16
UniProt Gene Name
PAM16
UniProt Synonym Gene Names
MAGMAS; TIM16; TIMM16
UniProt Entry Name
TIM16_HUMAN

Similar Products

Product Notes

The PAM16 pam16 (Catalog #AAA201319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAM16 antibody - C-terminal region reacts with Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PAM16 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PAM16 pam16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NYEHLFKVND KSVGGSFYLQ SKVVRAKERL DEELKIQAQE DREKGQMPHT. It is sometimes possible for the material contained within the vial of "PAM16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.