Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281840_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using PCDHB4 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit PCDHB4 Polyclonal Antibody | anti-PCDHB4 antibody

PCDHB4 Rabbit pAb

Gene Names
PCDHB4; PCDH-BETA4
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
PCDHB4, Antibody; PCDHB4 Rabbit pAb; PCDH-BETA4; PCDHB4; anti-PCDHB4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
EPIRYSVLEETESGSFVAHLAKDLGLGIGELASRSARVLSDDDKQRLQLDRQTGDLLLREKLDREELCGPIEPCVLHFQVFLEMPVQFFQGELLIQDINDHSPIFPEREVLLKILENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHILTRNHSEGKKYPDLVQDKPLDREEQPEFSLTLVALDGGSPPRSGTVMVRILIMDINDNAPEFVHTPYGVQVLENSPLDSPIVRVLARDIDAGNFGSVSYGLFQASDEIKQTFSINEVTGEI
Applicable Applications for anti-PCDHB4 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 28-300 of human PCDHB4 (NP_061761.1).
Positive Samples
293T, Raji, Mouse testis, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using PCDHB4 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281840_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using PCDHB4 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PCDHB4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA281840_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PCDHB4 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-PCDHB4 antibody
Background: This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
87,270 Da
NCBI Official Full Name
protocadherin beta 4
NCBI Official Synonym Full Names
protocadherin beta 4
NCBI Official Symbol
PCDHB4
NCBI Official Synonym Symbols
PCDH-BETA4
NCBI Protein Information
protocadherin beta-4
UniProt Protein Name
Protocadherin beta-4
UniProt Gene Name
PCDHB4
UniProt Synonym Gene Names
PCDH-beta-4
UniProt Entry Name
PCDB4_HUMAN

Similar Products

Product Notes

The PCDHB4 pcdhb4 (Catalog #AAA281840) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCDHB4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCDHB4 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PCDHB4 pcdhb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EPIRYSVLEE TESGSFVAHL AKDLGLGIGE LASRSARVLS DDDKQRLQLD RQTGDLLLRE KLDREELCGP IEPCVLHFQV FLEMPVQFFQ GELLIQDIND HSPIFPEREV LLKILENSQP GTLFPLLIAE DLDVGSNGLQ KYTISPNSHF HILTRNHSEG KKYPDLVQDK PLDREEQPEF SLTLVALDGG SPPRSGTVMV RILIMDINDN APEFVHTPYG VQVLENSPLD SPIVRVLARD IDAGNFGSVS YGLFQASDEI KQTFSINEVT GEI. It is sometimes possible for the material contained within the vial of "PCDHB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.