<
Rabbit PCK1 Polyclonal Antibody | anti-PCK1 antibody
PCK1 antibody - middle region
Gene Names
PCK1; PCKDC; PEPCK1; PEPCKC; PEPCK-C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PCK1, Antibody; PCK1 antibody - middle region; anti-PCK1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Sequence Length
622
Applicable Applications for anti-PCK1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PCK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-PCK1 AntibodyPositive Control: Lane 1: 80ug pig serum proteinPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:500Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)
WB (Western Blot)
(WB Suggested Anti-PCK1 AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: MCF7Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PCK1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-PCK1 antibody
This is a rabbit polyclonal antibody against PCK1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PCK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
phosphoenolpyruvate carboxykinase, cytosolic
NCBI Official Synonym Full Names
phosphoenolpyruvate carboxykinase 1
NCBI Official Symbol
PCK1
NCBI Official Synonym Symbols
PCKDC; PEPCK1; PEPCKC; PEPCK-C
NCBI Protein Information
phosphoenolpyruvate carboxykinase, cytosolic [GTP]
UniProt Protein Name
Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
UniProt Gene Name
PCK1
UniProt Synonym Gene Names
PEPCK1; PEPCK-C
UniProt Entry Name
PCKGC_HUMAN
