<
WB (Western Blot)
(WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit PDCD8 Polyclonal Antibody | anti-AIFM1 antibody
PDCD8 antibody - C-terminal region
Gene Names
AIFM1; AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PDCD8, Antibody; PDCD8 antibody - C-terminal region; anti-AIFM1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
Sequence Length
326
Applicable Applications for anti-AIFM1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateAIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(Host: RabbitTarget Name: AIFM1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: AIFM1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: AIFM1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: AIFM1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
IHC (Immunohiostchemistry)
(Rabbit Anti-AIFM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-AIFM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-AIFM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-AIFM1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-AIFM1 antibody
This is a rabbit polyclonal antibody against PDCD8. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
Target Description: AIFM1 (PDCD8) is a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, AIFM1 induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9.This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Three alternative transcripts encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-AIFM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Synonym Full Names
apoptosis inducing factor mitochondria associated 1
NCBI Official Symbol
AIFM1
NCBI Official Synonym Symbols
AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
NCBI Protein Information
apoptosis-inducing factor 1, mitochondrial
UniProt Protein Name
Apoptosis-inducing factor 1, mitochondrial
UniProt Gene Name
AIFM1
UniProt Synonym Gene Names
AIF; PDCD8
UniProt Entry Name
AIFM1_HUMAN
Similar Products
Product Notes
The AIFM1 aifm1 (Catalog #AAA198583) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD8 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AIFM1 aifm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VDSSLPTVGV FAKATAQDNP KSATEQSGTG IRSESETESE ASEITIPPST. It is sometimes possible for the material contained within the vial of "PDCD8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.