Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281621_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using PDE11A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse, Rat PDE11A Polyclonal Antibody | anti-PDE11A antibody

PDE11A Rabbit pAb

Gene Names
PDE11A; PPNAD2; FLJ23693; MGC133355; MGC133356; PDE11A
Reactivity
Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
PDE11A, Antibody; PDE11A Rabbit pAb; PDE11A; PPNAD2; anti-PDE11A antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NNAFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Applicable Applications for anti-PDE11A antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 712-933 of human PDE11A (NP_058649.3).
Cellular Location
Cytoplasm, cytosol
Positive Samples
Mouse brain, Mouse testis, Mouse liver, Rat brain, Rat testis, Rat liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using PDE11A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281621_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using PDE11A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PDE11A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281621_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PDE11A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-PDE11A antibody
Background: The 3', 5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3', 5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a member of the PDE protein superfamily. Mutations in this gene are a cause of Cushing disease and adrenocortical hyperplasia. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A isoform 1 [Homo sapiens]
NCBI Official Synonym Full Names
phosphodiesterase 11A
NCBI Official Symbol
PDE11A
NCBI Official Synonym Symbols
PPNAD2; FLJ23693; MGC133355; MGC133356; PDE11A
UniProt Protein Name
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
UniProt Gene Name
PDE11A
UniProt Entry Name
PDE11_HUMAN

Similar Products

Product Notes

The PDE11A pde11a (Catalog #AAA281621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE11A Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDE11A can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PDE11A pde11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NNAFQAKSGS ALAQLYGTSA TLEHHHFNHA VMILQSEGHN IFANLSSKEY SDLMQLLKQS ILATDLTLYF ERRTEFFELV SKGEYDWNIK NHRDIFRSML MTACDLGAVT KPWEISRQVA ELVTSEFFEQ GDRERLELKL TPSAIFDRNR KDELPRLQLE WIDSICMPLY QALVKVNVKL KPMLDSVATN RSKWEELHQK RLLASTASSS PASVMVAKED RN. It is sometimes possible for the material contained within the vial of "PDE11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.