<
WB (Western Blot)
(WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Rabbit PDK1 Polyclonal Antibody | anti-PDK1 antibody
PDK1 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDK1, Antibody; PDK1 antibody - middle region; anti-PDK1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY
Sequence Length
436
Applicable Applications for anti-PDK1 antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: PDK2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlPDK1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(Host: RabbitTarget Name: PDK2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlPDK1 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(Host: RabbitTarget Name: PDK1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PDK1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PDK1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PDK1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDK1 antibody
This is a rabbit polyclonal antibody against PDK1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PDK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial isoform 2
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 1
NCBI Official Symbol
PDK1
NCBI Protein Information
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 1, mitochondrial
UniProt Protein Name
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial
UniProt Gene Name
PDK1
UniProt Synonym Gene Names
PDHK1; PDH kinase 1
UniProt Entry Name
PDK1_HUMAN
Similar Products
Product Notes
The PDK1 pdk1 (Catalog #AAA197222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDK1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PDK1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PDK1 pdk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATMEHHANRG VYPPIQVHVT LGNEDLTVKM SDRGGGVPLR KIDRLFNYMY. It is sometimes possible for the material contained within the vial of "PDK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.