Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23464_WB8.jpg WB (Western Blot) (WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

Rabbit PDLIM5 Polyclonal Antibody | anti-PDLIM5 antibody

PDLIM5 antibody - N-terminal region

Gene Names
PDLIM5; L9; ENH; LIM; ENH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDLIM5, Antibody; PDLIM5 antibody - N-terminal region; anti-PDLIM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL
Sequence Length
596
Applicable Applications for anti-PDLIM5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

product-image-AAA23464_WB8.jpg WB (Western Blot) (WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23464_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23464_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23464_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23464_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23464_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

product-image-AAA23464_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: HepG2Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: PDLIM5Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)

product-image-AAA23464_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: PDLIM5Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2)
Related Product Information for anti-PDLIM5 antibody
This is a rabbit polyclonal antibody against PDLIM5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are scaffolds for the formation of multiprotein complexes. The proteins are involved in cytoskeleton organization, cell lineage specification, organ development, and oncogenesis. The encoded protein is also a member of the Enigma class of proteins, a family of proteins that possess a 100-amino acid PDZ domain in the N terminus and 1 to 3 LIM domains in the C terminus. Multiple transcript variants encoding different isoforms have been found for this gene, although not all of them have been fully characterized. The protein encoded by this gene is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are scaffolds for the formation of multiprotein complexes. The proteins are involved in cytoskeleton organization, cell lineage specification, organ development, and oncogenesis. The encoded protein is also a member of the Enigma class of proteins, a family of proteins that possess a 100-amino acid PDZ domain in the N terminus and 1 to 3 LIM domains in the C terminus. Multiple transcript variants encoding different isoforms have been found for this gene, although not all of them have been fully characterized.
Product Categories/Family for anti-PDLIM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
PDZ and LIM domain protein 5 isoform a
NCBI Official Synonym Full Names
PDZ and LIM domain 5
NCBI Official Symbol
PDLIM5
NCBI Official Synonym Symbols
L9; ENH; LIM; ENH1
NCBI Protein Information
PDZ and LIM domain protein 5
UniProt Protein Name
PDZ and LIM domain protein 5
UniProt Gene Name
PDLIM5
UniProt Synonym Gene Names
ENH
UniProt Entry Name
PDLI5_HUMAN

Similar Products

Product Notes

The PDLIM5 pdlim5 (Catalog #AAA23464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDLIM5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDLIM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDLIM5 pdlim5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNYSVSLVGP APWGFRLQGG KDFNMPLTIS SLKDGGKAAQ ANVRIGDVVL. It is sometimes possible for the material contained within the vial of "PDLIM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.