Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA77030_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis: De-waxed sections of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to glucagon. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.)

Rabbit Peptide tyrosine tyrosine Polyclonal Antibody | anti-PYY antibody

Peptide tyrosine tyrosine polyclonal antibody

Average rating 0.0
No ratings yet
Reactivity
Species Independent
Applications
Western Blot, Immunohistochemistry
Synonyms
Peptide tyrosine tyrosine, Antibody; Peptide tyrosine tyrosine polyclonal antibody; Peptide YY; PYY; Peptide tyrosine tyrosine, pAb; anti-PYY antibody
Ordering
Host
Rabbit
Reactivity
Species Independent
Clonality
Polyclonal
Specificity
Recognizes PYY in a wide range of species.
Form/Format
Liquid. Antiserum containing 10mM sodium azide.
Sequence Length
36
Applicable Applications for anti-PYY antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.).
Preparation and Storage
Long Term: -20 degree C
Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis: De-waxed sections of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to glucagon. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.)

product-image-AAA77030_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis: De-waxed sections of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to glucagon. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis: De-waxed section of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to PYY. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.)

product-image-AAA77030_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis: De-waxed section of Bouin-fixed fetal (14 day) rat pancreas stained with rabbit polyclonal antisera to PYY. Arrows indicate identical cell profiles. From Ali-Rachedi et al., 1984.)
Related Product Information for anti-PYY antibody
Peptide tyrosine tyrosine (PYY) is a 36 amino acid peptide, originally isolated from porcine gut, which exhibits striking sequence homology with members of the pancreatic polypeptide family, including neuropeptide tyrosine (NPY). The peptide is localised to enteroglucagon-containing (L/EG) and pancreatic (A) cells in many mammalian and nonmammalian species. PYY gene expression is upregulated by various growth factors, including growth hormone and insulin-like growth factor-1 and the physiological effects of PYY are mediated by G-protein (Galphai2) coupled Y-type receptors (‘Y2 receptors of a PYY-preferring subtype’). Various actions have been reported for PYY, including the inhibition of upper intestinal and exocrine pancreatic secretion, small intestinal water flux and as the mediator for the fat-induced ileal brake. The infusion of normal post-prandial concentrations of PYY[3-36] into human volunteers has been shown to significantly decrease appetite and reduce food intake, possibly via Y2R in the arcuate nucleus. This work stimulated a great deal of research activity showing that the truncated form of PYY reduced food intake in normal and obese humans and in rodents. Recently, the actions of PYY[3-36] and GLP-1[7-36] have been shown to inhibit food intake additively in humans and rats. Immunohistochemical studies on mice have shown that PYY is the earliest detectable peptide in both pancreatic islets and colonic endocrine cells, which suggest that PYY may be a useful marker for endocrine progenitor cells.
Product Categories/Family for anti-PYY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
4,242 Da
NCBI Official Full Name
Peptide YY
NCBI Official Symbol
PYY
NCBI Protein Information
peptide YY
UniProt Protein Name
Peptide YY
UniProt Gene Name
PYY
UniProt Synonym Gene Names
PYY

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PYY pyy (Catalog #AAA77030) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Peptide tyrosine tyrosine polyclonal antibody reacts with Species Independent and may cross-react with other species as described in the data sheet. AAA Biotech's Peptide tyrosine tyrosine can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PYY pyy for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Peptide tyrosine tyrosine, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.