<
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit anti-Human, Mouse Peroxiredoxin 1/PAG Polyclonal Antibody | anti-PAG antibody
[KD Validated] Peroxiredoxin 1/PAG Rabbit pAb
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Peroxiredoxin 1/PAG; Polyclonal Antibody; [KD Validated] Peroxiredoxin 1/PAG Rabbit pAb; PRDX1; MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2; anti-PAG antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
PPARAAELTDEDFMRRQILEMSAEEDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHNATTGYEELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELDLGQ
Applicable Applications for anti-PAG antibody
Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
WB: 1:500-1:2000
IF/ICC: 1:50-1:200
IF/ICC: 1:50-1:200
Positive Samples
HeLa, MCF7, RAW264.7, Mouse kidney, Rat liver
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human Peroxiredoxin 1/PAG (NP_001189360.1).
Cellular Location
cytoplasm, cytosol, extracellular exosome, extracellular space, melanosome, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of PC-12 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of MCF7 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of MCF7 cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using [KO Validated] Peroxiredoxin 1/PAG Rabbit pAb at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and Peroxiredoxin 1/PAG Rabbit pAb knockdown (KD) HeLa cells, using Peroxiredoxin 1/PAG Rabbit pAb antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and Peroxiredoxin 1/PAG Rabbit pAb knockdown (KD) HeLa cells, using Peroxiredoxin 1/PAG Rabbit pAb antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of various lysates, using Peroxiredoxin 1/PAG Rabbit pAb antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of various lysates, using Peroxiredoxin 1/PAG Rabbit pAb antibody at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
Related Product Information for anti-PAG antibody
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-PAG antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The PAG bsn (Catalog #AAA28415) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] Peroxiredoxin 1/PAG Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Peroxiredoxin 1/PAG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC). WB: 1:500-1:2000 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the PAG bsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PPARAAELTD EDFMRRQILE MSAEEDNLEE DDTATSGRGL AKHGTQKGGP RPRPEPSQEP AALPKRRLPH NATTGYEELL PEGGSAEATD GSGTLQGGLR RFKTIELNST GSYGHELDLG Q. It is sometimes possible for the material contained within the vial of "Peroxiredoxin 1/PAG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
