Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46413_ICC8.jpg ICC (Immunocytochemistry) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, ICCICC: A549 Cell)

Peroxiredoxin 4 Polyclonal Antibody | anti-PRDX4 antibody

Anti-Peroxiredoxin 4 Antibody

Average rating 0.0
No ratings yet
Gene Names
PRDX4; PRX-4; AOE372; AOE37-2; HEL-S-97n
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Peroxiredoxin 4, Antibody; Anti-Peroxiredoxin 4 Antibody; Peroxiredoxin-4; Antioxidant enzyme 372; Antioxidant enzyme AOE372; AOE37 2; AOE37-2; AOE372; EC 1.11.1.15; Peroxiredoxin IV; Peroxiredoxin4; PRDX 4; PRDX4; PRDX4_HUMAN; PRX 4; Prx IV; Prx-IV; PRX4; PrxIV; Thioredoxin dependent peroxide reductase A0372; Thioredoxin Peroxidase (Antioxidant Enzyme); Thioredoxin peroxidase; Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372; TRANK antibody; peroxiredoxin 4; anti-PRDX4 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
271
Applicable Applications for anti-PRDX4 antibody
ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

ICC (Immunocytochemistry)

(Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, ICCICC: A549 Cell)

product-image-AAA46413_ICC8.jpg ICC (Immunocytochemistry) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, ICCICC: A549 Cell)

IHC (Immunohistochemistry)

(Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Human Tonsil Tissue)

product-image-AAA46413_IHC10.jpg IHC (Immunohistochemistry) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Human Tonsil Tissue)

IHC (Immunohistochemisry)

(Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46413_IHC11.jpg IHC (Immunohistochemisry) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46413_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, Western blottingAll lanes: Anti Peroxiredoxin 4 (AAA46413) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)

product-image-AAA46413_WB15.jpg WB (Western Blot) (Anti- Peroxiredoxin 4 Picoband antibody, AAA46413, Western blottingAll lanes: Anti Peroxiredoxin 4 (AAA46413) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)
Related Product Information for anti-PRDX4 antibody
Description: Rabbit IgG polyclonal antibody for Peroxiredoxin-4(PRDX4) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

Background: PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.
References
1. Jin, D.-Y, Chae, H. Z, Rhee, S. G, Jeang, K.-T. Regulatory role for a novel human thioredoxin peroxidase in NF-kappa-B activation. J. Biol. Chem. 272: 30952-30961, 1997.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,540 Da
NCBI Official Full Name
peroxiredoxin-4
NCBI Official Synonym Full Names
peroxiredoxin 4
NCBI Official Symbol
PRDX4
NCBI Official Synonym Symbols
PRX-4; AOE372; AOE37-2; HEL-S-97n
NCBI Protein Information
peroxiredoxin-4
UniProt Protein Name
Peroxiredoxin-4
UniProt Gene Name
PRDX4
UniProt Synonym Gene Names
AOE37-2; Prx-IV
UniProt Entry Name
PRDX4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRDX4 prdx4 (Catalog #AAA46413) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Peroxiredoxin 4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Peroxiredoxin 4 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PRDX4 prdx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Peroxiredoxin 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.