Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.)

Rabbit PFN1 Polyclonal Antibody | anti-PFN1 antibody

PFN1 antibody - N-terminal region

Gene Names
PFN1; ALS18
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PFN1, Antibody; PFN1 antibody - N-terminal region; UBC; FUS; STUB1; SUMO1; NEDD8; MDM2; ASB12; ASB2; ASB1; YWHAQ; SRPK1; ESR1; RAD52; RAD51; ACTB; VCAM1; ITGA4; FN1; ATF2; LIG4; SET; ACAA2; LOC440434; MRPL53; SRPRB; CAND1; CUL3; CDK2; ISG15; ELAVL1; AI837181; Akap12; Csnk1e; Mapk13; UCHL5; WIPF2; LRIF1; M; anti-PFN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg.mL (varies by lot)
Sequence
Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Sequence Length
140
Applicable Applications for anti-PFN1 antibody
Western Blot (WB)
Predicted Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1
Protein size (#AA)
140 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.)

WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.)

WB (Western Blot)

(WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot) (WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(Lanes:1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissuePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

WB (Western Blot) (Lanes:1. 20 ug murine non-pregnant uteria tissue 2. 20 ug murine non-laboring uterine tissue 3. 20 ug murine laboring uterine tissue 4. 20 ug murine preterm laboring uterine tissuePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

WB (Western Blot)

(Lanes:1. 20 ug human pregnant uterine muscle cells + hormone 2. 20 ug human pregnant uterine muscle cells - hormonePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

WB (Western Blot) (Lanes:1. 20 ug human pregnant uterine muscle cells + hormone 2. 20 ug human pregnant uterine muscle cells - hormonePrimary Antibody Dilution:1:2000Secondary Antibody:Goat anti-rabbit-Alexa Fluor 680Secondary Antibody Dilution:1:25,000Gene Name:PFN1Submitted by:Anonymous)

IHC (Immunohistochemistry)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry) (Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TonsilPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SpleenPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry) (Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SpleenPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry) (Rabbit Anti-PFN1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-PFN1 antibody
Description: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
profilin-1
NCBI Official Synonym Full Names
profilin 1
NCBI Official Symbol
PFN1
NCBI Official Synonym Symbols
ALS18
NCBI Protein Information
profilin-1
UniProt Protein Name
Profilin-1
UniProt Gene Name
PFN1
UniProt Entry Name
PROF1_HUMAN

Similar Products

Product Notes

The PFN1 pfn1 (Catalog #AAA23532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PFN1 antibody - N-terminal region reacts with Tested Species Reactivity: Human, Mouse Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PFN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PFN1 pfn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGWNAYIDNL MADGTCQDAA IVGYKDSPSV WAAVPGKTFV NITPAEVGVL. It is sometimes possible for the material contained within the vial of "PFN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.