<
IHC (Immunohistochemistry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Human Lung Cancer Tissue)
PGRMC1 Polyclonal Antibody | anti-PGRMC1 antibody
Anti-PGRMC1 Antibody
Gene Names
PGRMC1; MPR; HPR6.6
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PGRMC1, Antibody; Anti-PGRMC1 Antibody; Membrane-associated progesterone receptor component 1; HPR6.6; Membrane associated progesterone receptor component 1; mPR; PGRC1_HUMAN; PGRMC; Pgrmc1; Progesterone binding protein; Progesterone receptor membrane component 1; progesterone receptor membrane component 1; anti-PGRMC1 antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
143
Applicable Applications for anti-PGRMC1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67-102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK), identical to the related mouse sequence, and different from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistochemistry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Human Lung Cancer Tissue)
IHC (Immunohistochemistry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Human Lung Cancer Tissue)
IHC (Immunohistochemisry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Rat Liver Tissue)
IHC (Immunohistochemisry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Rat Liver Tissue)
IHC (Immunohiostchemistry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Mouse Kidney Tissue)
IHC (Immunohiostchemistry)
(Anti- PGRMC1 Picoband antibody, AAA46475, IHC(P)IHC(P): Mouse Kidney Tissue)
WB (Western Blot)
(Anti- PGRMC1 Picoband antibody, AAA46475, Western blottingAll lanes: Anti PGRMC1 (AAA46475) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 26KDObserved bind size: 26KD)
WB (Western Blot)
(Anti- PGRMC1 Picoband antibody, AAA46475, Western blottingAll lanes: Anti PGRMC1 (AAA46475) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 26KDObserved bind size: 26KD)
Related Product Information for anti-PGRMC1 antibody
Description: Rabbit IgG polyclonal antibody for Membrane-associated progesterone receptor component 1(PGRMC1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Background: Progesterone receptor membrane component 1 (PGRMC1) is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the PGRMC1 protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis.
Background: Progesterone receptor membrane component 1 (PGRMC1) is a protein which co-purifies with progesterone binding proteins in the liver and ovary. In humans, the PGRMC1 protein is encoded by the PGRMC1 gene. The Sigma-2 receptor was recently identified as potentially being the same as PGRMC1. The sole biochemical function of PGRMC1 is heme-binding. PGRMC1 shares key structural motifs with cytochrome b5. It binds and activates P450 proteins, which are important in drug, hormone and lipid metabolism. Also, PGRMC1 binds to PAIR-BP1 (plasminogen activator inhibitor RNA-binding protein-1). However, its expression outside of the reproductive tract and in males suggests multiple functions for the protein. These may include binding to Insig (insulin-induced gene), which regulates cholesterol synthesis.
References
1. Gerdes D, Wehling M, Leube B, Falkenstein E (Jul 1998). "Cloning and tissue expression of two putative steroid membrane receptors".Biological Chemistry 379 (7): 907-11. 2. Meyer C, Schmid R, Scriba PC, Wehling M (Aug 1996). "Purification and partial sequencing of high-affinity progesterone-binding site(s) from porcine liver membranes". European Journal of Biochemistry / FEBS 239(3): 726-31. 3. Xu J, Zeng C, Chu W, Pan F, Rothfuss JM, Zhang F, Tu Z, Zhou D, Zeng D, Vangveravong S, Johnston F, Spitzer D, Chang KC, Hotchkiss RS, Hawkins WG, Wheeler KT, Mach RH (2011). "Identification of the PGRMC1 protein complex as the putative sigma-2 receptor binding site". Nature Communications 2 (2): 380.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15,879 Da
NCBI Official Full Name
membrane-associated progesterone receptor component 1 isoform 2
NCBI Official Synonym Full Names
progesterone receptor membrane component 1
NCBI Official Symbol
PGRMC1
NCBI Official Synonym Symbols
MPR; HPR6.6
NCBI Protein Information
membrane-associated progesterone receptor component 1
UniProt Protein Name
Membrane-associated progesterone receptor component 1
UniProt Gene Name
PGRMC1
UniProt Synonym Gene Names
HPR6.6; PGRMC; mPR
UniProt Entry Name
PGRC1_HUMAN
Similar Products
Product Notes
The PGRMC1 pgrmc1 (Catalog #AAA46475) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PGRMC1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PGRMC1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PGRMC1 pgrmc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGRMC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.