Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200085_WB11.jpg WB (Western Blot) (WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit anti-Human PHF19 Polyclonal Antibody | anti-PHF19 antibody

PHF19 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PHF19; PCL3; MTF2L1; TDRD19B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PHF19, Antibody; PHF19 antibody - C-terminal region; anti-PHF19 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET
Sequence Length
207
Applicable Applications for anti-PHF19 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PHF19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

product-image-AAA200085_WB11.jpg WB (Western Blot) (WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Lanes:1. 30 ug HBEC lysate2. 30 ug A549 lysate3. 30 ug Calu-6 lysate4. 30 ug NCI358 lysate5. 30 ug NCI841 lysate6. 30 ug NCI1299 lysate7. 30 ug NCI1650 lysate8. 30 ug NCI1975 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:PHF19Submitted by:Anonymous)

product-image-AAA200085_WB13.jpg WB (Western Blot) (Lanes:1. 30 ug HBEC lysate2. 30 ug A549 lysate3. 30 ug Calu-6 lysate4. 30 ug NCI358 lysate5. 30 ug NCI841 lysate6. 30 ug NCI1299 lysate7. 30 ug NCI1650 lysate8. 30 ug NCI1975 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:PHF19Submitted by:Anonymous)

WB (Western Blot)

(Lanes:1. 30 ug control HEK-293T lysate2. 30 ug hPCL3L-DYKDDDDK transfected HEK-293T lysate3. 30 ug hPCL3L-MYC transfected HEK-293T lysate4. 30 ug hPCL3L-HA transfected HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:PHF19Submitted by:Anonymous)

product-image-AAA200085_WB15.jpg WB (Western Blot) (Lanes:1. 30 ug control HEK-293T lysate2. 30 ug hPCL3L-DYKDDDDK transfected HEK-293T lysate3. 30 ug hPCL3L-MYC transfected HEK-293T lysate4. 30 ug hPCL3L-HA transfected HEK-293T lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:3000Gene Name:PHF19Submitted by:Anonymous)
Related Product Information for anti-PHF19 antibody
This is a rabbit polyclonal antibody against PHF19. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Product Categories/Family for anti-PHF19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
PHD finger protein 19 isoform b
NCBI Official Synonym Full Names
PHD finger protein 19
NCBI Official Symbol
PHF19
NCBI Official Synonym Symbols
PCL3; MTF2L1; TDRD19B
NCBI Protein Information
PHD finger protein 19
UniProt Protein Name
PHD finger protein 19
UniProt Gene Name
PHF19
UniProt Synonym Gene Names
PCL3; hPCL3
UniProt Entry Name
PHF19_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PHF19 phf19 (Catalog #AAA200085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHF19 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PHF19 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PHF19 phf19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRCIFALAVR VSLPSSPVPA SPASSSGADQ RLPSQSLSSK QKGHTWALET. It is sometimes possible for the material contained within the vial of "PHF19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.