Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197218_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysatePHOX2A is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit PHOX2A Polyclonal Antibody | anti-PHOX2A antibody

PHOX2A antibody - N-terminal region

Gene Names
PHOX2A; ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PHOX2A, Antibody; PHOX2A antibody - N-terminal region; anti-PHOX2A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVPYKFFPEPSGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTRE
Sequence Length
284
Applicable Applications for anti-PHOX2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PHOX2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysatePHOX2A is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA197218_WB13.jpg WB (Western Blot) (WB Suggested Anti-PHOX2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysatePHOX2A is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-PHOX2A antibody)

product-image-AAA197218_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Testis tissue at an antibody concentration of 5ug/ml using anti-PHOX2A antibody)
Related Product Information for anti-PHOX2A antibody
This is a rabbit polyclonal antibody against PHOX2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PHOX2A contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. PHOX2A has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene.The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
401
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
paired mesoderm homeobox protein 2A
NCBI Official Synonym Full Names
paired like homeobox 2A
NCBI Official Symbol
PHOX2A
NCBI Official Synonym Symbols
ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
NCBI Protein Information
paired mesoderm homeobox protein 2A
UniProt Protein Name
Paired mesoderm homeobox protein 2A
UniProt Gene Name
PHOX2A
UniProt Synonym Gene Names
ARIX; PMX2A
UniProt Entry Name
PHX2A_HUMAN

Similar Products

Product Notes

The PHOX2A phox2a (Catalog #AAA197218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PHOX2A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PHOX2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PHOX2A phox2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVPYKFFPEP SGLHEKRKQR RIRTTFTSAQ LKELERVFAE THYPDIYTRE. It is sometimes possible for the material contained within the vial of "PHOX2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.