Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200451_WB10.jpg WB (Western Blot) (WB Suggested Anti-PIK3R5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

Rabbit PIK3R5 Polyclonal Antibody | anti-PIK3R5 antibody

PIK3R5 antibody - N-terminal region

Gene Names
PIK3R5; p101; FOAP-2; P101-PI3K; F730038I15Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIK3R5, Antibody; PIK3R5 antibody - N-terminal region; anti-PIK3R5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS
Sequence Length
880
Applicable Applications for anti-PIK3R5 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PIK3R5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

product-image-AAA200451_WB10.jpg WB (Western Blot) (WB Suggested Anti-PIK3R5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200451_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA200451_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA200451_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PIK3R5Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PIK3R5 antibody
This is a rabbit polyclonal antibody against PIK3R5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit (Brock et al., 2003 [PubMed 12507995]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3253 AF128881.1 1-3253
Product Categories/Family for anti-PIK3R5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
phosphoinositide 3-kinase regulatory subunit 5 isoform 1
NCBI Official Synonym Full Names
phosphoinositide-3-kinase regulatory subunit 5
NCBI Official Symbol
PIK3R5
NCBI Official Synonym Symbols
p101; FOAP-2; P101-PI3K; F730038I15Rik
NCBI Protein Information
phosphoinositide 3-kinase regulatory subunit 5
UniProt Protein Name
Phosphoinositide 3-kinase regulatory subunit 5
UniProt Gene Name
PIK3R5
UniProt Synonym Gene Names
PI3-kinase regulatory subunit 5
UniProt Entry Name
PI3R5_HUMAN

Similar Products

Product Notes

The PIK3R5 pik3r5 (Catalog #AAA200451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3R5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PIK3R5 pik3r5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HRFLTWPVPY CSICQELLTF IDAELKAPGI SYQRLVRAEQ GLPIRSHRSS. It is sometimes possible for the material contained within the vial of "PIK3R5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.