Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281138_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF-7 cells using PIN1 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human PIN1 Polyclonal Antibody | anti-PIN1 antibody

PIN1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
PIN1; DOD; UBL5
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
PIN1, Antibody; PIN1 Polyclonal Antibody; DOD; UBL5; anti-PIN1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Sequence Length
163
Applicable Applications for anti-PIN1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human PIN1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus, Nucleus speckle
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of MCF-7 cells using PIN1 antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281138_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF-7 cells using PIN1 antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PIN1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281138_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PIN1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-PIN1 antibody
Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-PIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 18kDa
Observed: 17kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
NCBI Official Synonym Full Names
peptidylprolyl cis/trans isomerase, NIMA-interacting 1
NCBI Official Symbol
PIN1
NCBI Official Synonym Symbols
DOD; UBL5
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Gene Name
PIN1
UniProt Synonym Gene Names
PPIase Pin1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PIN1 pin1 (Catalog #AAA281138) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIN1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIN1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PIN1 pin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADEEKLPPG WEKRMSRSSG RVYYFNHITN ASQWERPSGN SSSGGKNGQG EPARVRCSHL LVKHSQSRRP SSWRQEKITR TKEEALELIN GYIQKIKSGE EDFESLASQF SDCSSAKARG DLGAFSRGQM QKPFEDASFA LRTGEMSGPV FTDSGIHIIL RTE. It is sometimes possible for the material contained within the vial of "PIN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.