Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282314_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug Placental alkaline phosphatase (PLAP) antibody. Western blot was performed from the immunoprecipitate using Placental alkaline phosphatase (PLAP) antibody at a dilution of 1:1000.)

Rabbit anti-Human Placental alkaline phosphatase (PLAP) Polyclonal Antibody | anti-PLAP antibody

Placental alkaline phosphatase (PLAP) Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
DLL3; SCDO1
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
Placental alkaline phosphatase (PLAP), Antibody; Placental alkaline phosphatase (PLAP) Rabbit pAb; ALPP; ALP; PALP; PLAP; PLAP-1; alkaline phosphatase; placental; anti-PLAP antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK
Applicable Applications for anti-PLAP antibody
IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3).
Cellular Location
Cell membrane, GPI-anchor, Lipid-anchor
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug Placental alkaline phosphatase (PLAP) antibody. Western blot was performed from the immunoprecipitate using Placental alkaline phosphatase (PLAP) antibody at a dilution of 1:1000.)

product-image-AAA282314_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug Placental alkaline phosphatase (PLAP) antibody. Western blot was performed from the immunoprecipitate using Placental alkaline phosphatase (PLAP) antibody at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of extracts of HeLa cells, using Placental alkaline phosphatase (PLAP) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA282314_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HeLa cells, using Placental alkaline phosphatase (PLAP) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-PLAP antibody
The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. The protein is primarily expressed in placental and endometrial tissue; however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.
Product Categories/Family for anti-PLAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,178 Da
NCBI Official Full Name
delta-like protein 3 isoform 2
NCBI Official Synonym Full Names
delta like canonical Notch ligand 3
NCBI Official Symbol
DLL3
NCBI Official Synonym Symbols
SCDO1
NCBI Protein Information
delta-like protein 3
UniProt Protein Name
Delta-like protein 3
UniProt Gene Name
DLL3
UniProt Synonym Gene Names
Delta3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PLAP dll3 (Catalog #AAA282314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Placental alkaline phosphatase (PLAP) Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Placental alkaline phosphatase (PLAP) can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the PLAP dll3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSQDAGSRLL AGTPEPSVHA LPDALNNLRT QEGSGDGPSS SVDWNRPEDV DPQGIYVISA PSIYAREVAT PLFPPLHTGR AGQRQHLLFP YPSSILSVK. It is sometimes possible for the material contained within the vial of "Placental alkaline phosphatase (PLAP), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.