Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281665_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse lung using PMEPA1 antibody at dilution of 1:100 (40x lens).)

Rabbit PMEPA1 Polyclonal Antibody | anti-PMEPA1 antibody

PMEPA1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PMEPA1; STAG1; TMEPAI
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
PMEPA1, Antibody; PMEPA1 Rabbit pAb; PMEPA1; STAG1; TMEPAI; anti-PMEPA1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Applicable Applications for anti-PMEPA1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1).
Cellular Location
Early endosome membrane, Golgi apparatus membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse lung using PMEPA1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281665_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse lung using PMEPA1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human placenta using PMEPA1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281665_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human placenta using PMEPA1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using PMEPA1 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281665_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using PMEPA1 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-PMEPA1 antibody
Background: This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-PMEPA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,609 Da
NCBI Official Full Name
transmembrane prostate androgen-induced protein isoform d
NCBI Official Synonym Full Names
prostate transmembrane protein, androgen induced 1
NCBI Official Symbol
PMEPA1
NCBI Official Synonym Symbols
STAG1; TMEPAI
NCBI Protein Information
transmembrane prostate androgen-induced protein; solid tumor-associated 1 protein; transmembrane, prostate androgen induced RNA
UniProt Protein Name
Transmembrane prostate androgen-induced protein
UniProt Gene Name
PMEPA1
UniProt Synonym Gene Names
STAG1; TMEPAI
UniProt Entry Name
PMEPA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PMEPA1 pmepa1 (Catalog #AAA281665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PMEPA1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PMEPA1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PMEPA1 pmepa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSSNSGISAT CYGSGGRMEG PPPTYSEVIG HYPGSSFQHQ QSSGPPSLLE GTRLHHTHIA PLESAAIWSK EKDKQKGHPL. It is sometimes possible for the material contained within the vial of "PMEPA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.