Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46841_IHC13.jpg IHC (Immunohiostchemistry) (PML Protein was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit PML Polyclonal Antibody | anti-PML antibody

Anti-PML Protein Antibody

Average rating 0.0
No ratings yet
Gene Names
PML; MYL; RNF71; PP8675; TRIM19
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
PML, Antibody; Anti-PML Protein Antibody; MYL; Pml; PP8675; Protein PML; RNF 71; TRIM 19; P29590; promyelocytic leukemia; anti-PML antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
633
Applicable Applications for anti-PML antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD), different from the related mouse sequence by eight amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(PML Protein was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46841_IHC13.jpg IHC (Immunohiostchemistry) (PML Protein was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of PML Protein expression in SW620 whole cell lysates (lane 1) and U2OS whole cell lysates (lane 2). PML Protein at 72KD, 90KD was detected using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46841_WB15.jpg WB (Western Blot) (Western blot analysis of PML Protein expression in SW620 whole cell lysates (lane 1) and U2OS whole cell lysates (lane 2). PML Protein at 72KD, 90KD was detected using rabbit anti- PML Protein Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-PML antibody
Rabbit IgG polyclonal antibody for Protein PML(PML) detection.
Background: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
References
1. Dyck, J. A., Maul, G. G., Miller, W. H., Jr., Chen, J. D., Kakizuka, A., Evans, R. M. A novel macromolecular structure is a target of the promyelocyte-retinoic acid receptor oncoprotein. Cell 76: 333-343, 1994.
2. Giorgi, C., Ito, K., Lin, H.-K., Santangelo, C., Wieckowski, M. R., Lebiedzinska, M., Bononi, A., Bonora, M., Duszynski, J., Bernardi, R., Rizzuto, R., Tacchetti, C., Pinton, P., Pandolfi, P. P. PML regulates apoptosis at endoplasmic reticulum by modulating calcium release. Science 330: 1247-1251, 2010.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47,575 Da
NCBI Official Full Name
protein PML isoform 6
NCBI Official Synonym Full Names
promyelocytic leukemia
NCBI Official Symbol
PML
NCBI Official Synonym Symbols
MYL; RNF71; PP8675; TRIM19
NCBI Protein Information
protein PML
UniProt Protein Name
Protein PML
UniProt Gene Name
PML
UniProt Synonym Gene Names
MYL; PP8675; RNF71; TRIM19

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PML pml (Catalog #AAA46841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-PML Protein Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PML can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PML pml for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PML, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.