Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197507_WB10.jpg WB (Western Blot) (WB Suggested Anti-PML Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Rabbit PML Polyclonal Antibody | anti-PML antibody

PML antibody - C-terminal region

Gene Names
PML; MYL; RNF71; PP8675; TRIM19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PML, Antibody; PML antibody - C-terminal region; anti-PML antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Specificity
isoform 1, 9, 10 and 11 specific
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR
Sequence Length
540
Applicable Applications for anti-PML antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 85%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PML
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PML Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA197507_WB10.jpg WB (Western Blot) (WB Suggested Anti-PML Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PMLSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA197507_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PMLSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-PML AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197507_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-PML AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: Nucleus, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PML antibody)

product-image-AAA197507_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PML antibody)
Related Product Information for anti-PML antibody
This is a rabbit polyclonal antibody against PML. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
PML protein, partial
NCBI Official Synonym Full Names
promyelocytic leukemia
NCBI Official Symbol
PML
NCBI Official Synonym Symbols
MYL; RNF71; PP8675; TRIM19
NCBI Protein Information
protein PML
UniProt Protein Name
Protein PML
UniProt Gene Name
PML
UniProt Synonym Gene Names
MYL; PP8675; RNF71; TRIM19
UniProt Entry Name
PML_HUMAN

Similar Products

Product Notes

The PML pml (Catalog #AAA197507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PML antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PML can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PML pml for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGPSTLRVLD ENLADPQAED RPLVFFDLKI DNETQKISQL AAVNRESKFR. It is sometimes possible for the material contained within the vial of "PML, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.