Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199944_WB13.jpg WB (Western Blot) (WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePOLR3F is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit POLR3F Polyclonal Antibody | anti-POLR3F antibody

POLR3F antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
POLR3F; RPC6; RPC39
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR3F, Antibody; POLR3F antibody - middle region; anti-POLR3F antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE
Sequence Length
316
Applicable Applications for anti-POLR3F antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POLR3F
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePOLR3F is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA199944_WB13.jpg WB (Western Blot) (WB Suggested Anti-POLR3F Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePOLR3F is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: POLR3FSample Type: Human 293TAntibody Dilution: 1.0ug/mlPOLR3F is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA199944_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: POLR3FSample Type: Human 293TAntibody Dilution: 1.0ug/mlPOLR3F is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-POLR3F antibody
This is a rabbit polyclonal antibody against POLR3F. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.The protein encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.
Product Categories/Family for anti-POLR3F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC6 isoform 1
NCBI Official Synonym Full Names
RNA polymerase III subunit F
NCBI Official Symbol
POLR3F
NCBI Official Synonym Symbols
RPC6; RPC39
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC6
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC6
UniProt Gene Name
POLR3F
UniProt Synonym Gene Names
RNA polymerase III subunit C6; RPC39
UniProt Entry Name
RPC6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The POLR3F polr3f (Catalog #AAA199944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR3F antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLR3F can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POLR3F polr3f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNQQCFKFLQ SKAETARESK QNPMIQRNSS FASSHEVWKY ICELGISKVE. It is sometimes possible for the material contained within the vial of "POLR3F, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.