WB (Western Blot)
(WB Suggested Anti-Pou3f3 antibody Titration: 1 ug/mLSample Type: Human heart)
Rabbit Pou3f3 Polyclonal Antibody | anti-POU3F3 antibody
Pou3f3 Antibody - C-terminal region
Gene Names
Pou3f3; Brn1; RHS1
Reactivity
Dog, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Pou3f3, Antibody; Pou3f3 Antibody - C-terminal region; anti-POU3F3 antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS
Sequence Length
497
Applicable Applications for anti-POU3F3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Pou3f3 antibody Titration: 1 ug/mLSample Type: Human heart)
WB (Western Blot)
(WB Suggested Anti-Pou3f3 antibody Titration: 1 ug/mLSample Type: Human heart)
WB (Western Blot)
(Host: RabbitTarget Name: Pou3f3Sample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: Pou3f3Sample Type: Rat Testis lysatesAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-Pou3f3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
IHC (Immunohistochemistry)
(Rabbit Anti-Pou3f3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-POU3F3 antibody
This is a rabbit polyclonal antibody against Pou3f3. It was validated on Western Blot
Target Description: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development
Target Description: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development
Product Categories/Family for anti-POU3F3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
POU domain, class 3, transcription factor 3
NCBI Official Synonym Full Names
POU class 3 homeobox 3
NCBI Official Symbol
Pou3f3
NCBI Official Synonym Symbols
Brn1; RHS1
NCBI Protein Information
POU domain, class 3, transcription factor 3
UniProt Protein Name
POU domain, class 3, transcription factor 3
UniProt Gene Name
Pou3f3
UniProt Synonym Gene Names
Brn-1; Brn1; Rhs2; Brain-1; Brn-1
UniProt Entry Name
PO3F3_RAT
Similar Products
Product Notes
The POU3F3 pou3f3 (Catalog #AAA200754) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pou3f3 Antibody - C-terminal region reacts with Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Pou3f3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the POU3F3 pou3f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVRVWFCNRR QKEKRMTPPG IQQQTPDDVY SQVGTVSADT PPPHHGLQTS. It is sometimes possible for the material contained within the vial of "Pou3f3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.