Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197513_WB11.jpg WB (Western Blot) (WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysatePOU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Rabbit POU3F3 Polyclonal Antibody | anti-POU3F3 antibody

POU3F3 antibody - N-terminal region

Gene Names
POU3F3; BRN1; OTF8; oct-8; brain-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POU3F3, Antibody; POU3F3 antibody - N-terminal region; anti-POU3F3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA
Sequence Length
500
Applicable Applications for anti-POU3F3 antibody
WB (Western Blot)
Homology
Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POU3F3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysatePOU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

product-image-AAA197513_WB11.jpg WB (Western Blot) (WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysatePOU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3)

WB (Western Blot)

(Host: RabbitTarget Name: POU3F3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA197513_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: POU3F3Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: POU3F3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA197513_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: POU3F3Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-POU3F3 antibody
This is a rabbit polyclonal antibody against POU3F3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082].[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
POU domain, class 3, transcription factor 3
NCBI Official Synonym Full Names
POU class 3 homeobox 3
NCBI Official Symbol
POU3F3
NCBI Official Synonym Symbols
BRN1; OTF8; oct-8; brain-1
NCBI Protein Information
POU domain, class 3, transcription factor 3
UniProt Protein Name
POU domain, class 3, transcription factor 3
UniProt Gene Name
POU3F3
UniProt Synonym Gene Names
BRN1; OTF8; Brain-1; Brn-1; Oct-8; OTF-8
UniProt Entry Name
PO3F3_HUMAN

Similar Products

Product Notes

The POU3F3 pou3f3 (Catalog #AAA197513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POU3F3 antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POU3F3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POU3F3 pou3f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGGGGGGGA GGGGGGMQPG SAAVTSGAYR GDPSSVKMVQ SDFMQGAMAA. It is sometimes possible for the material contained within the vial of "POU3F3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.