Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28319_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit PP2A-B56delta/PR61delta/PPP2R5D Polyclonal Antibody | anti-PP2A-B56delta/PR61delta/PPP2R5D antibody

PP2A-B56delta/PR61delta/PPP2R5D Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PPP2R5D; B56D
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
PP2A-B56delta/PR61delta/PPP2R5D, Antibody; PP2A-B56delta/PR61delta/PPP2R5D Rabbit pAb; PPP2R5D; B56D; MRD35; B56delta; anti-PP2A-B56delta/PR61delta/PPP2R5D antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT
Applicable Applications for anti-PP2A-B56delta/PR61delta/PPP2R5D antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
IF: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56delta/PR61delta/PP2A-B56delta/PR61delta/PPP2R5D (NP_006236.1).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
HT-29, 293T, HeLa, Mouse heart, Mouse kidney, Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28319_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28319_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

product-image-AAA28319_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human thyroid cancer using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

product-image-AAA28319_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human thyroid cancer using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

product-image-AAA28319_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28319_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-PP2A-B56delta/PR61delta/PPP2R5D antibody
Background: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-PP2A-B56delta/PR61delta/PPP2R5D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,992 Da
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform isoform 4
NCBI Official Synonym Full Names
protein phosphatase 2, regulatory subunit B', delta
NCBI Official Symbol
PPP2R5D
NCBI Official Synonym Symbols
B56D
NCBI Protein Information
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform; PP2A B subunit isoform B'-delta; PP2A B subunit isoform R5-delta; PP2A B subunit isoform B56-delta; PP2A B subunit isoform PR61-delta; PP2A, B subunit, B' delta isoform; PP2A
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
UniProt Gene Name
PPP2R5D
UniProt Entry Name
2A5D_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PP2A-B56delta/PR61delta/PPP2R5D ppp2r5d (Catalog #AAA28319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PP2A-B56delta/PR61delta/PPP2R5D Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PP2A-B56delta/PR61delta/PPP2R5D can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:100-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the PP2A-B56delta/PR61delta/PPP2R5D ppp2r5d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LYRNSKSHWN KTIHGLIYNA LKLFMEMNQK LFDDCTQQYK AEKQKGRFRM KEREEMWQKI EELARLNPQY PMFRAPPPLP PVYSMETETP TAEDIQLLKR T. It is sometimes possible for the material contained within the vial of "PP2A-B56delta/PR61delta/PPP2R5D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.