WB (Western Blot)
(WB Suggested Anti-PPARG Antibody Titration: 1.25ug/mlPositive Control: 293T cell lysate)
Rabbit PPARG Polyclonal Antibody | anti-PPARG antibody
PPARG antibody - N-terminal region
Gene Names
PPARG; GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
PPARG, Antibody; PPARG antibody - N-terminal region; anti-PPARG antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI
Sequence Length
505
Applicable Applications for anti-PPARG antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PPARG Antibody Titration: 1.25ug/mlPositive Control: 293T cell lysate)
WB (Western Blot)
(WB Suggested Anti-PPARG Antibody Titration: 1.25ug/mlPositive Control: 293T cell lysate)
IHC (Immunohistochemistry)
(Mouse cornea and eyelidPrimary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit-AlexaFluor-546Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PPARG: Green DAPI: RedGene Name :Ppar Gamma Submitted by :Anonymous)
IHC (Immunohistochemistry)
(Mouse cornea and eyelidPrimary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit-AlexaFluor-546Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PPARG: Green DAPI: RedGene Name :Ppar Gamma Submitted by :Anonymous)
Related Product Information for anti-PPARG antibody
This is a rabbit polyclonal antibody against PPARG. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.
Target Description: PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.
Product Categories/Family for anti-PPARG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor gamma isoform 2
NCBI Official Synonym Full Names
peroxisome proliferator activated receptor gamma
NCBI Official Symbol
PPARG
NCBI Official Synonym Symbols
GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARgamma
NCBI Protein Information
peroxisome proliferator-activated receptor gamma
UniProt Protein Name
Peroxisome proliferator-activated receptor gamma
UniProt Gene Name
PPARG
UniProt Synonym Gene Names
NR1C3; PPAR-gamma
UniProt Entry Name
PPARG_HUMAN
Similar Products
Product Notes
The PPARG pparg (Catalog #AAA197482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPARG antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PPARG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PPARG pparg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHSFDIKPFT TVDFSSISTP HYEDIPFTRT DPVVADYKYD LKLQEYQSAI. It is sometimes possible for the material contained within the vial of "PPARG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.