Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199654_WB8.jpg WB (Western Blot) (WB Suggested Anti-PPAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePPAT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit PPAT Polyclonal Antibody | anti-PPAT antibody

PPAT antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
PPAT; GPAT; PRAT; ATASE
Reactivity
Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPAT, Antibody; PPAT antibody - C-terminal region; anti-PPAT antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Sequence Length
517
Applicable Applications for anti-PPAT antibody
WB (Western Blot)
Homology
Dog: 92%; Horse: 77%; Human: 100%; Mouse: 86%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PPAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PPAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePPAT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA199654_WB8.jpg WB (Western Blot) (WB Suggested Anti-PPAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysatePPAT is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: PPATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA199654_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: PPATSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PPATSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199654_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PPATSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PPATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199654_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PPATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PPATSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA199654_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: PPATSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PPAT antibody
This is a rabbit polyclonal antibody against PPAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
amidophosphoribosyltransferase
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate amidotransferase
NCBI Official Symbol
PPAT
NCBI Official Synonym Symbols
GPAT; PRAT; ATASE
NCBI Protein Information
amidophosphoribosyltransferase
UniProt Protein Name
Amidophosphoribosyltransferase
UniProt Gene Name
PPAT
UniProt Synonym Gene Names
GPAT; ATase; GPAT
UniProt Entry Name
PUR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PPAT ppat (Catalog #AAA199654) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPAT antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPAT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PPAT ppat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEGIKFKKQK EKKHDIMIQE NGNGLECFEK SGHCTACLTG KYPVELEW. It is sometimes possible for the material contained within the vial of "PPAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.