Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA21301_IHC6.jpg IHC (Immunohistchemistry) (PPP1CB Antibody-Immunohistochemistry of paraffin-embedded human lung cancer using PPP1CB antibody at dilution of 1:200 (200x lens).)

Rabbit anti-Mouse, Human PPP1CB Polyclonal Antibody | anti-PPP1CB antibody

PPP1CB Rabbit anti-Human Polyclonal Antibody

Gene Names
PPP1CB; PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
Reactivity
Mouse, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
PPP1CB, Antibody; PPP1CB Rabbit anti-Human Polyclonal Antibody; IHC-plus PPP1CB Antibody; PPP1CB; PP-1B; pp1 delta; PPP1CD; Protein phosphatase 1-beta; Protein phosphatase 1-delta; PP1beta; PP1 beta; anti-PPP1CB antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human PPP1CB
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-PPP1CB antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IF: 1:50-1:200
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 37kDa, while the observed MW by Western blot was 30kDa.
Target
Human PPP1CB
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-327 of human PPP1CB (NP_002700.1). MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Conjugation
Unconjugated
Family
Protein Phosphatase
Subfamily
PP1
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(PPP1CB Antibody-Immunohistochemistry of paraffin-embedded human lung cancer using PPP1CB antibody at dilution of 1:200 (200x lens).)

product-image-AAA21301_IHC6.jpg IHC (Immunohistchemistry) (PPP1CB Antibody-Immunohistochemistry of paraffin-embedded human lung cancer using PPP1CB antibody at dilution of 1:200 (200x lens).)

IHC (Immunohistochemistry)

(PPP1CB Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer tissue.)

product-image-AAA21301_IHC5.jpg IHC (Immunohistochemistry) (PPP1CB Antibody-Immunohistochemistry of paraffin-embedded human esophageal cancer tissue.)

IHC (Immunohistochemistry)

(PPP1CB Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21301_IHC4.jpg IHC (Immunohistochemistry) (PPP1CB Antibody-Human Colon: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(PPP1CB Antibody-Western blot analysis of extracts of various cell lines, using PPP1CB antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

product-image-AAA21301_WB3.jpg WB (Western Blot) (PPP1CB Antibody-Western blot analysis of extracts of various cell lines, using PPP1CB antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.)

ICC (Immunocytochemistry)

(PPP1CB Antibody-Immunofluorescence analysis of U2OS cells.)

product-image-AAA21301_ICC2.jpg ICC (Immunocytochemistry) (PPP1CB Antibody-Immunofluorescence analysis of U2OS cells.)

ICC (Immunocytochemistry)

(PPP1CB Antibody-Immunofluorescence analysis of U2OS cells using PPP1CB antibody. Blue: DAPI for nuclear staining.)

product-image-AAA21301_ICC.jpg ICC (Immunocytochemistry) (PPP1CB Antibody-Immunofluorescence analysis of U2OS cells using PPP1CB antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-PPP1CB antibody
PPP1CB antibody is an unconjugated rabbit polyclonal antibody to PPP1CB from human. It is reactive with human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
serine/threonine-protein phosphatase PP1-beta catalytic subunit isoform 1
NCBI Official Synonym Full Names
protein phosphatase 1 catalytic subunit beta
NCBI Official Symbol
PPP1CB
NCBI Official Synonym Symbols
PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p
NCBI Protein Information
serine/threonine-protein phosphatase PP1-beta catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-beta catalytic subunit
UniProt Gene Name
PPP1CB
UniProt Synonym Gene Names
PP-1B; PPP1CD
UniProt Entry Name
PP1B_HUMAN

Similar Products

Product Notes

The PPP1CB ppp1cb (Catalog #AAA21301) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1CB Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1CB can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IF: 1:50-1:200 IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 37kDa, while the observed MW by Western blot was 30kDa. Researchers should empirically determine the suitability of the PPP1CB ppp1cb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP1CB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.