Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200658_WB13.jpg WB (Western Blot) (WB Suggested Anti-PPP2R1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit PPP2R1A Polyclonal Antibody | anti-PPP2R1A antibody

PPP2R1A antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PPP2R1A; MRD36; PP2AA; PR65A; PP2AAALPHA; PP2A-Aalpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP2R1A, Antibody; PPP2R1A antibody - middle region; anti-PPP2R1A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
Sequence Length
589
Applicable Applications for anti-PPP2R1A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP2R1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PPP2R1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

product-image-AAA200658_WB13.jpg WB (Western Blot) (WB Suggested Anti-PPP2R1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: PPP2R1ASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA200658_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PPP2R1ASample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP2R1A antibody
This is a rabbit polyclonal antibody against PPP2R1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzy

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2 scaffold subunit Aalpha
NCBI Official Symbol
PPP2R1A
NCBI Official Synonym Symbols
MRD36; PP2AA; PR65A; PP2AAALPHA; PP2A-Aalpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
UniProt Gene Name
PPP2R1A
UniProt Entry Name
2AAA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PPP2R1A ppp2r1a (Catalog #AAA200658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R1A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R1A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PPP2R1A ppp2r1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVAKSLQKIG PILDNSTLQS EVKPILEKLT QDQDVDVKYF AQEALTVLSL. It is sometimes possible for the material contained within the vial of "PPP2R1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.