Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281091_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PPP2R2A antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse PPP2R2A Polyclonal Antibody | anti-PPP2R2A antibody

PPP2R2A Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
PPP2R2A; B55A; PR52A; PR55A; B55ALPHA; PR55alpha
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
PPP2R2A, Antibody; PPP2R2A Polyclonal Antibody; B55A; B55ALPHA; PR52A; PR55A; PR55alpha; anti-PPP2R2A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCD
Sequence Length
457
Applicable Applications for anti-PPP2R2A antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human PPP2R2A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using PPP2R2A antibody. Blue: DAPI for nuclear staining.)

product-image-AAA281091_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using PPP2R2A antibody. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using PPP2R2A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281091_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using PPP2R2A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-PPP2R2A antibody
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-PPP2R2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 51kDa; 53kDa
Observed: 52kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform 2
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit Balpha
NCBI Official Symbol
PPP2R2A
NCBI Official Synonym Symbols
B55A; PR52A; PR55A; B55ALPHA; PR55alpha
NCBI Protein Information
serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
UniProt Gene Name
PPP2R2A

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PPP2R2A ppp2r2a (Catalog #AAA281091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R2A Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R2A can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PPP2R2A ppp2r2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGAGGGNDI QWCFSQVKGA VDDDVAEADI ISTVEFNHSG ELLATGDKGG RVVIFQQEQE NKIQSHSRGE YNVYSTFQSH EPEFDYLKSL EIEEKINKIR WLPQKNAAQF LLSTNDKTIK LWKISERDKR PEGYNLKEED GRYRDPTTVT TLRVPVFRPM DLMVEASPRR IFANAHTYHI NSISINSDYE TYLSADDLRI NLWHLEITDR SFNIVDIKPA NMEELTEVIT AAEFHPNSCN TFVYSSSKGT IRLCD. It is sometimes possible for the material contained within the vial of "PPP2R2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.