WB (Western Blot)
(WB Suggested Anti-PPP2R3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
Rabbit PPP2R3A Polyclonal Antibody | anti-PPP2R3A antibody
PPP2R3A antibody - N-terminal region
Gene Names
PPP2R3A; PR72; PR130; PPP2R3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PPP2R3A, Antibody; PPP2R3A antibody - N-terminal region; anti-PPP2R3A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
Sequence Length
1150
Applicable Applications for anti-PPP2R3A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PPP2R3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
WB (Western Blot)
(WB Suggested Anti-PPP2R3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysate)
IHC (Immunohistochemistry)
(Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-PPP2R3A antibody)
IHC (Immunohistochemistry)
(Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-PPP2R3A antibody)
Related Product Information for anti-PPP2R3A antibody
This is a rabbit polyclonal antibody against PPP2R3A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu
Target Description: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu
Product Categories/Family for anti-PPP2R3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
130kDa
NCBI Official Full Name
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform 1
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit B''alpha
NCBI Official Symbol
PPP2R3A
NCBI Official Synonym Symbols
PR72; PR130; PPP2R3
NCBI Protein Information
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
UniProt Protein Name
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
UniProt Gene Name
PPP2R3A
UniProt Synonym Gene Names
PPP2R3
UniProt Entry Name
P2R3A_HUMAN
Similar Products
Product Notes
The PPP2R3A ppp2r3a (Catalog #AAA200589) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP2R3A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R3A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PPP2R3A ppp2r3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSSVEEKPLS HRNSLDTNLT SMFLQNFSEE DLVTQILEKH KIDNFSSGTD. It is sometimes possible for the material contained within the vial of "PPP2R3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.