Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46438_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of THP-1 cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing THP-1 cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

anti-Human, Rat PPT1 Polyclonal Antibody | anti-PPT1 antibody

Anti-PPT1 Antibody

Gene Names
PPT1; PPT; CLN1; INCL
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PPT1, Antibody; Anti-PPT1 Antibody; Palmitoyl-protein thioesterase 1; Ceroid palmitoyl palmitoyl protein thioesterase 1; CLN1; EC 3.1.2.22; INCL; Palmitoyl protein hydrolase 1; Palmitoyl protein thioesterase 1; Palmitoyl-protein hydrolase 1; PPT; PPT-1; PPT1; PPT1_HUMAN; palmitoyl-protein thioesterase 1; anti-PPT1 antibody
Ordering
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
306
Applicable Applications for anti-PPT1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of THP-1 cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing THP-1 cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46438_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of THP-1 cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing THP-1 cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of SiHa cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing SiHa cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46438_FCM10.jpg FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of SiHa cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing SiHa cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of U937 cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing U937 cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46438_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U937 cells using anti-PPT1 antibody (AAA46438).Overlay histogram showing U937 cells stained with AAA46438 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PPT1 Antibody (AAA46438,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of PPT1 using anti- PPT1 antibody (AAA46438).PPT1 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- PPT1 Antibody (AAA46438) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46438_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of PPT1 using anti- PPT1 antibody (AAA46438).PPT1 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- PPT1 Antibody (AAA46438) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of PPT1 using anti- PPT1 antibody (AAA46438).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysates,Lane 2: mouse brain tissue lysates,Lane 3: rat liver tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: HEPG2 whole Cell lysates,Lane 6: 293T whole cell lysates,Lane 7: MCF-7 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- PPT1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PPT1.)

product-image-AAA46438_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of PPT1 using anti- PPT1 antibody (AAA46438).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat brain tissue lysates,Lane 2: mouse brain tissue lysates,Lane 3: rat liver tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: HEPG2 whole Cell lysates,Lane 6: 293T whole cell lysates,Lane 7: MCF-7 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- PPT1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PPT1.)
Related Product Information for anti-PPT1 antibody
Description: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human;Rat.

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: palmitoyl-protein thioesterase 1". 2. Hellsten E, Vesa J, Speer MC, Mäkelä TP, Järvelä I, Alitalo K, Ott J, Peltonen L (June 1993). "Refined assignment of the infantile neuronal ceroid lipofuscinosis (INCL, CLN1) locus at 1p32: incorporation of linkage disequilibrium in multipoint analysis". Genomics 16 (3): 720-5. 3. Vesa J, Hellsten E, Verkruyse LA, Camp LA, Rapola J, Santavuori P, Hofmann SL, Peltonen L (August 1995). "Mutations in the palmitoyl protein thioesterase gene causing infantile neuronal ceroid lipofuscinosis".Nature 376 (6541): 584-7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,094 Da
NCBI Official Full Name
palmitoyl-protein thioesterase 1 isoform 1
NCBI Official Synonym Full Names
palmitoyl-protein thioesterase 1
NCBI Official Symbol
PPT1
NCBI Official Synonym Symbols
PPT; CLN1; INCL
NCBI Protein Information
palmitoyl-protein thioesterase 1
UniProt Protein Name
Palmitoyl-protein thioesterase 1
UniProt Gene Name
PPT1
UniProt Synonym Gene Names
PPT; PPT-1
UniProt Entry Name
PPT1_HUMAN

Similar Products

Product Notes

The PPT1 ppt1 (Catalog #AAA46438) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PPT1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPT1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PPT1 ppt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.