Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201099_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRKAR2A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit PRKAR2A Polyclonal Antibody | anti-PRKAR2A antibody

PRKAR2A antibody - middle region

Gene Names
PRKAR2A; PKR2; PRKAR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKAR2A, Antibody; PRKAR2A antibody - middle region; anti-PRKAR2A antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDR
Sequence Length
404
Applicable Applications for anti-PRKAR2A antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKAR2A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

product-image-AAA201099_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRKAR2A AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

WB (Western Blot)

(Host: MouseTarget Name: PRKAR2ASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA201099_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: PRKAR2ASample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKAR2A antibody
This is a rabbit polyclonal antibody against PRKAR2A. It was validated on Western Blot

Target Description: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. It may interact with various A-kinase anchoring proteins and determine the subcellular localization of cAMP-dependent protein kinase. This subunit has been shown to regulate protein transport from endosomes to the Golgi apparatus and further to the endoplasmic reticulum (ER).
Product Categories/Family for anti-PRKAR2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
cAMP-dependent protein kinase type II-alpha regulatory subunit isoform a
NCBI Official Synonym Full Names
protein kinase cAMP-dependent type II regulatory subunit alpha
NCBI Official Symbol
PRKAR2A
NCBI Official Synonym Symbols
PKR2; PRKAR2
NCBI Protein Information
cAMP-dependent protein kinase type II-alpha regulatory subunit
UniProt Protein Name
cAMP-dependent protein kinase type II-alpha regulatory subunit
UniProt Gene Name
PRKAR2A
UniProt Synonym Gene Names
PKR2; PRKAR2
UniProt Entry Name
KAP2_HUMAN

Similar Products

Product Notes

The PRKAR2A prkar2a (Catalog #AAA201099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKAR2A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKAR2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKAR2A prkar2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DILVTKDNQT RSVGQYDNRG SFGELALMYN TPRAATIVAT SEGSLWGLDR. It is sometimes possible for the material contained within the vial of "PRKAR2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.