Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281125_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse kidney using PRKCB antibody at dilution of 1:200 (40x lens).)

Rabbit anti-Mouse PRKCB Polyclonal Antibody | anti-PRKCB antibody

PRKCB Polyclonal Antibody

Gene Names
PRKCB; PKCB; PRKCB1; PRKCB2; PKC-beta
Reactivity
Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
PRKCB, Antibody; PRKCB Polyclonal Antibody; PKC-beta; PKCB; PRKCB1; PRKCB2; anti-PRKCB antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDF
Sequence Length
673
Applicable Applications for anti-PRKCB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human PRKCB
Immunogen Species
Human
Cellular Location
Cytoplasm, Membrane, Nucleus, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse kidney using PRKCB antibody at dilution of 1:200 (40x lens).)

product-image-AAA281125_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse kidney using PRKCB antibody at dilution of 1:200 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using PRKCB antibody at dilution of 1:200 (40x lens).)

product-image-AAA281125_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse lung using PRKCB antibody at dilution of 1:200 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of mouse liver, using PRKCB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 50s.)

product-image-AAA281125_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of mouse liver, using PRKCB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 50s.)
Related Product Information for anti-PRKCB antibody
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-PRKCB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 76kDa; 77kDa
Observed: 77kDa
NCBI Official Full Name
protein kinase C beta type isoform 2
NCBI Official Synonym Full Names
protein kinase C beta
NCBI Official Symbol
PRKCB
NCBI Official Synonym Symbols
PKCB; PRKCB1; PRKCB2; PKC-beta
NCBI Protein Information
protein kinase C beta type
UniProt Protein Name
Protein kinase C beta type
UniProt Gene Name
PRKCB
UniProt Synonym Gene Names
PKCB; PRKCB1; PKC-B; PKC-beta

Similar Products

Product Notes

The PRKCB prkcb (Catalog #AAA281125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCB Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PRKCB prkcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADPAAGPPP SEGEESTVRF ARKGALRQKN VHEVKNHKFT ARFFKQPTFC SHCTDFIWGF GKQGFQCQVC CFVVHKRCHE FVTFSCPGAD KGPASDDPRS KHKFKIHTYS SPTFCDHCGS LLYGLIHQGM KCDTCMMNVH KRCVMNVPSL CGTDHTERRG RIYIQAHIDR DVLIVLVRDA KNLVPMDPNG LSDPYVKLKL IPDPKSESKQ KTKTIKCSLN PEWNETFRFQ LKESDKDRRL SVEIWDWDLT SRNDF. It is sometimes possible for the material contained within the vial of "PRKCB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.