Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199188_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit PRKCZ Polyclonal Antibody | anti-PRKCZ antibody

PRKCZ antibody - N-terminal region

Gene Names
PRKCZ; PKC2; PKC-ZETA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKCZ, Antibody; PRKCZ antibody - N-terminal region; anti-PRKCZ antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
Sequence Length
409
Applicable Applications for anti-PRKCZ antibody
WB (Western Blot)
Homology
Cow: 77%; Dog: 75%; Guinea Pig: 75%; Horse: 75%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

product-image-AAA199188_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRKCZ Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-PRKCZ AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199188_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PRKCZ AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PRKCZ antibody
This is a rabbit polyclonal antibody against PRKCZ. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
protein kinase C zeta type isoform 2
NCBI Official Synonym Full Names
protein kinase C zeta
NCBI Official Symbol
PRKCZ
NCBI Official Synonym Symbols
PKC2; PKC-ZETA
NCBI Protein Information
protein kinase C zeta type
UniProt Protein Name
Protein kinase C zeta type
UniProt Gene Name
PRKCZ
UniProt Synonym Gene Names
PKC2
UniProt Entry Name
KPCZ_HUMAN

Similar Products

Product Notes

The PRKCZ prkcz (Catalog #AAA199188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCZ antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCZ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKCZ prkcz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSVMPSQEP PVDDKNEDAD LPSEETDGIA YISSSRKHDS IKDDSEDLKP. It is sometimes possible for the material contained within the vial of "PRKCZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.