Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA131509_WB13.jpg WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

Rabbit Protectin (CD59) Polyclonal Antibody | anti-CD59 antibody

Polyclonal Antibody to Protectin (CD59)

Average rating 0.0
No ratings yet
Gene Names
CD59; MACIF; MAC-IP; Protectin; QmoA-10351; QnpA-17056
Reactivity
Human, Simian
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry
Purity
Affinity Chromatography
Synonyms
Protectin (CD59), Antibody; Polyclonal Antibody to Protectin (CD59); anti-CD59 antibody
Ordering
Host
Rabbit
Reactivity
Human, Simian
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against CD59. It has been selected for its ability to recognize CD59 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-HSGHSLQCYN CPNPTTDCKT AINCSSGFDT CLIARAGLQV YNQCWKFANC NYNDISTLLK ESELRYFCCK KDLCNFNEQL ESGGTSL
Applicable Applications for anti-CD59 antibody
WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Immunogen
Recombinant CD59 (His21~Leu107) expressed in E.coli.
Cross Reactivity
Human
Conjugated Antibody
The APC conjugated antibody version of this item is also available as
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

WB (Western Blot)

(Western Blot: Sample: Recombinant protein.)

product-image-AAA131509_WB13.jpg WB (Western Blot) (Western Blot: Sample: Recombinant protein.)

WB (Western Blot)

(Western Blot: Sample: Human Milk; Primary Ab: 1ug/ml Rabbit Anti-Simian CD59 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

product-image-AAA131509_WB15.jpg WB (Western Blot) (Western Blot: Sample: Human Milk; Primary Ab: 1ug/ml Rabbit Anti-Simian CD59 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,008 Da
NCBI Official Full Name
CD59 glycoprotein isoform X1
NCBI Official Symbol
CD59
NCBI Official Synonym Symbols
MACIF; MAC-IP; Protectin; QmoA-10351; QnpA-17056
NCBI Protein Information
CD59 glycoprotein
UniProt Protein Name
CD59 glycoprotein
UniProt Gene Name
CD59
UniProt Synonym Gene Names
MAC-IP; MACIF

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD59 cd59 (Catalog #AAA131509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Protectin (CD59) reacts with Human, Simian and may cross-react with other species as described in the data sheet. AAA Biotech's Protectin (CD59) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA, IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the CD59 cd59 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-HSGHSLQ CYN CPNPTTDCKT AINCSSGFDT CLIARAGLQV YNQCWKFANC NYNDISTLLK ESELRYFCCK KDLCNFNEQL ESGGTSL. It is sometimes possible for the material contained within the vial of "Protectin (CD59), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.