WB (Western Blot)
(WB Suggested Anti-PSME3 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysatePSME3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Rabbit PSME3 Polyclonal Antibody | anti-PSME3 antibody
PSME3 Antibody - N-terminal region
Gene Names
PSME3; Ki; PA28G; HEL-S-283; PA28gamma; REG-GAMMA; PA28-gamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PSME3, Antibody; PSME3 Antibody - N-terminal region; anti-PSME3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ
Sequence Length
267
Applicable Applications for anti-PSME3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PSME3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PSME3 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysatePSME3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(WB Suggested Anti-PSME3 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysatePSME3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
IHC (Immunohiostchemistry)
(Rabbit Anti-PSME3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohiostchemistry)
(Rabbit Anti-PSME3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Sample Type: Human TonsilAnti-PSME3 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
IHC (Immunohistochemistry)
(Sample Type: Human TonsilAnti-PSME3 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-PSME3 antibody
This is a rabbit polyclonal antibody against PSME3. It was validated on Western Blot
Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.
Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring.
Product Categories/Family for anti-PSME3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
proteasome activator complex subunit 3 isoform 2
NCBI Official Synonym Full Names
proteasome activator subunit 3
NCBI Official Symbol
PSME3
NCBI Official Synonym Symbols
Ki; PA28G; HEL-S-283; PA28gamma; REG-GAMMA; PA28-gamma
NCBI Protein Information
proteasome activator complex subunit 3
UniProt Protein Name
Proteasome activator complex subunit 3
UniProt Gene Name
PSME3
UniProt Synonym Gene Names
REG-gamma; PA28g; PA28gamma
UniProt Entry Name
PSME3_HUMAN
Similar Products
Product Notes
The PSME3 psme3 (Catalog #AAA199674) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSME3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PSME3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PSME3 psme3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PILNIHDLTQ IHSDMNLPVP DPILLTNSHD GLDGPTYKKR RLDECEEAFQ. It is sometimes possible for the material contained within the vial of "PSME3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.