Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197684_WB10.jpg WB (Western Blot) (WB Suggested Anti-PTHLH Antibody Titration: 2.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit PTHLH Polyclonal Antibody | anti-PTHLH antibody

PTHLH antibody - middle region

Gene Names
PTHLH; HHM; PLP; BDE2; PTHR; PTHRP
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
PTHLH, Antibody; PTHLH antibody - middle region; anti-PTHLH antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Sequence Length
175
Applicable Applications for anti-PTHLH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTHLH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PTHLH Antibody Titration: 2.0ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA197684_WB10.jpg WB (Western Blot) (WB Suggested Anti-PTHLH Antibody Titration: 2.0ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Sample Type: Human , Mouse, RatPrimary antibody dilution: 1:1000Secondary antibody: Goat anti-rabbit HRPSecondary antibody dilution:1:2000)

product-image-AAA197684_WB11.jpg WB (Western Blot) (Sample Type: Human , Mouse, RatPrimary antibody dilution: 1:1000Secondary antibody: Goat anti-rabbit HRPSecondary antibody dilution:1:2000)

IHC (Immunohiostchemistry)

(Rabbit Anti-PTHLH AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of collecting tubule and renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197684_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-PTHLH AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of collecting tubule and renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(IHC Information:Rabbit Anti-PTHLH AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197684_IHC15.jpg IHC (Immunohistochemistry) (IHC Information:Rabbit Anti-PTHLH AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-PTHLH antibody
This is a rabbit polyclonal antibody against PTHLH. It was validated on Western Blot and immunohistochemistry

Target Description: PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
parathyroid hormone-related protein isoform 2 preproprotein
NCBI Official Synonym Full Names
parathyroid hormone like hormone
NCBI Official Symbol
PTHLH
NCBI Official Synonym Symbols
HHM; PLP; BDE2; PTHR; PTHRP
NCBI Protein Information
parathyroid hormone-related protein
UniProt Protein Name
Parathyroid hormone-related protein
UniProt Gene Name
PTHLH
UniProt Synonym Gene Names
PTHRP; PTH-rP; PTHrP; PLP
UniProt Entry Name
PTHR_HUMAN

Similar Products

Product Notes

The PTHLH pthlh (Catalog #AAA197684) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTHLH antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTHLH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PTHLH pthlh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YKEQPLKTPG KKKKGKPGKR KEQEKKKRRT RSAWLDSGVT GSGLEGDHLS. It is sometimes possible for the material contained within the vial of "PTHLH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.