Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200107_WB8.jpg WB (Western Blot) (WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit PTOV1 Polyclonal Antibody | anti-PTOV1 antibody

PTOV1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PTOV1; ACID2; PTOV-1
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PTOV1, Antibody; PTOV1 antibody - N-terminal region; anti-PTOV1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN
Sequence Length
416
Applicable Applications for anti-PTOV1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA200107_WB8.jpg WB (Western Blot) (WB Suggested Anti-PTOV1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePTOV1 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: PTOV1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA200107_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: PTOV1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PTOV1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA200107_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PTOV1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PTOV1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA200107_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PTOV1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PTOV1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200107_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PTOV1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PTOV1 antibody
This is a rabbit polyclonal antibody against PTOV1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
prostate tumor-overexpressed gene 1 protein isoform 1
NCBI Official Synonym Full Names
PTOV1 extended AT-hook containing adaptor protein
NCBI Official Symbol
PTOV1
NCBI Official Synonym Symbols
ACID2; PTOV-1
NCBI Protein Information
prostate tumor-overexpressed gene 1 protein
UniProt Protein Name
Prostate tumor-overexpressed gene 1 protein
UniProt Gene Name
PTOV1
UniProt Synonym Gene Names
ACID2; PTOV-1
UniProt Entry Name
PTOV1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTOV1 ptov1 (Catalog #AAA200107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTOV1 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTOV1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PTOV1 ptov1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSTAKLKRTL PCQAYVNQGE NLETDQWPQK LIMQLIPQQL LTTLGPLFRN. It is sometimes possible for the material contained within the vial of "PTOV1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.