Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46330_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing A431 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

PTP4A2 Polyclonal Antibody | anti-PTP4A2 antibody

Anti-PTP4A2 Antibody

Average rating 0.0
No ratings yet
Gene Names
PTP4A2; HH13; OV-1; PRL2; HH7-2; PRL-2; PTP4A; HU-PP-1; PTPCAAX2; ptp-IV1a; ptp-IV1b
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PTP4A2, Antibody; Anti-PTP4A2 Antibody; Protein tyrosine phosphatase type IVA 2; BM 008; EC 3.1.3.48; HH 13; HH13; HH7 2; HU PP 1; HUPP 1; HUPP1; OV 1; OV1; phosphatase of regenerating liver 2; PRL 2; PRL2; Protein tyrosine phosphatase 4a2; protein tyrosine phosphatase IVA; protein tyrosine phosphatase IVA2; Protein tyrosine phosphatase of regenerating liver 2; protein tyrosine phosphatase type IVA 2; Protein tyrosine phosphatase type IVA member 2 isoform 1; protein tyrosine phosphatase type IVA, member 2; PTP (CAAXII); ptp IV1a; ptp IV1b; PTP4A; PTPCAAX2; TP4A2_HUMAN; anti-PTP4A2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No Cross Reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
142
Applicable Applications for anti-PTP4A2 antibody
FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant detection
AAA Biotech provides a series of assays reacted with primary antibodies.
Antibody can be be supported by chemiluminescence kit in WB, supported by in IHC (P).
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 5. Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing A431 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46330_FACS8.jpg FCM/FACS (Flow Cytometry) (Figure 5. Flow Cytometry analysis of A431 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing A431 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 4. Flow Cytometry analysis of PC-3 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing PC-3 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46330_FCM10.jpg FCM/FACS (Flow Cytometry) (Figure 4. Flow Cytometry analysis of PC-3 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing PC-3 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of U937 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing U937 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46330_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U937 cells using anti-PTP4A2 antibody (AAA46330).Overlay histogram showing U937 cells stained with AAA46330 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-PTP4A2 Antibody (AAA46330,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of PTP4A2 using anti-PTP4A2 antibody (AAA46330).PTP4A2 was detected in paraffin-embedded section of Human Prostatic Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PTP4A2 Antibody (AAA46330) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA46330_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of PTP4A2 using anti-PTP4A2 antibody (AAA46330).PTP4A2 was detected in paraffin-embedded section of Human Prostatic Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PTP4A2 Antibody (AAA46330) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of PTP4A2 using anti-PTP4A2 antibody (AAA46330).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Skeletal Muscle Tissue Lysate,Lane 2: Rat Thymus Tissue Lysate,Lane 3: Mouse Brain Tissue Lysate,Lane 4: Mouse Thymus Tissue Lysate,Lane 5: 22RV1 Whole Cell Lysate,Lane 6: MCF-7 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PTP4A2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PTP4A2 at approximately 19KD. The expected band size for PTP4A2 is at 19KD.)

product-image-AAA46330_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of PTP4A2 using anti-PTP4A2 antibody (AAA46330).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Skeletal Muscle Tissue Lysate,Lane 2: Rat Thymus Tissue Lysate,Lane 3: Mouse Brain Tissue Lysate,Lane 4: Mouse Thymus Tissue Lysate,Lane 5: 22RV1 Whole Cell Lysate,Lane 6: MCF-7 Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PTP4A2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PTP4A2 at approximately 19KD. The expected band size for PTP4A2 is at 19KD.)
Related Product Information for anti-PTP4A2 antibody
Description: Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
References
1. "Entrez Gene: PTP4A2 protein tyrosine phosphatase type IVA, member 2". 2. Zeng Q, Hong W, Tan YH (Apr 1998). "Mouse PRL-2 and PRL-3, two potentially prenylated protein tyrosine phosphatases homologous to PRL-1". Biochem Biophys Res Commun 244 (2): 421-7. 3. Zhao Z, Lee CC, Monckton DG, Yazdani A, Coolbaugh MI, Li X, Bailey J, Shen Y, Caskey CT (Sep 1996). "Characterization and genomic mapping of genes and pseudogenes of a new human protein tyrosine phosphatase".Genomics 35 (1): 172-81.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,367 Da
NCBI Official Full Name
protein tyrosine phosphatase type IVA 2 isoform 3
NCBI Official Synonym Full Names
protein tyrosine phosphatase type IVA, member 2
NCBI Official Symbol
PTP4A2
NCBI Official Synonym Symbols
HH13; OV-1; PRL2; HH7-2; PRL-2; PTP4A; HU-PP-1; PTPCAAX2; ptp-IV1a; ptp-IV1b
NCBI Protein Information
protein tyrosine phosphatase type IVA 2
UniProt Protein Name
Protein tyrosine phosphatase type IVA 2
UniProt Gene Name
PTP4A2
UniProt Synonym Gene Names
PRL2; PTPCAAX2; PRL-2
UniProt Entry Name
TP4A2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTP4A2 ptp4a2 (Catalog #AAA46330) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PTP4A2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTP4A2 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PTP4A2 ptp4a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTP4A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.